SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 412418.BRE_571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412418.BRE_571
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 412418.BRE_571
Sequence length 106
Comment (Borrelia recurrentis A1)
Sequence
MSFMIYKPEGELIVNNIFKVKEDLLNILKNMKEKETLVINLANVEKIDITFIQILYASNK
YAKDRNLFIKIEYPSDEVLSLLIYGGFLIDIEDIDNLDLGLSLIEF
Download sequence
Identical sequences B5RPR6
gi|203288006|ref|YP_002223021.1| 412418.BRE_571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]