SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 412694.BALH_1833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412694.BALH_1833
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily NfeD domain-like 1.15e-16
Family NfeD domain-like 0.0028
Further Details:      
 
Weak hits

Sequence:  412694.BALH_1833
Domain Number - Region: 12-62
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0222
Family Clc chloride channel 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 412694.BALH_1833
Sequence length 144
Comment (Bacillus thuringiensis Al Hakam)
Sequence
MHMAAWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFVPEALLLQVVAGAIVS
LTLTFFTKRISKNFREAKGFTDTVDMLVGKKGIVMQAITNETNGIVKVDGDTWTAVADAP
IDTGEKVVVIKRNSTILQVKKESE
Download sequence
Identical sequences A0RD59
412694.BALH_1833 gi|118477508|ref|YP_894659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]