SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 412694.BALH_3055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412694.BALH_3055
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000628
Family Sfri0576-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 412694.BALH_3055
Sequence length 157
Comment (Bacillus thuringiensis Al Hakam)
Sequence
MESLSLFHALQFNLIDFMGYFRIIVAKGDDFRLCKLNISTTVFGDIIVTRLIGKIKTDDV
YEWFNDFEQVCQQFISEGRKYKLLVDRKGYTPDHFSVQKAWKDKFFNETILNHSKAIVFL
LEEGEILNYLQQSNTKECVKFFDDYEQAVVWLNEYPI
Download sequence
Identical sequences A0RGH0
gi|118478669|ref|YP_895820.1| 412694.BALH_3055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]