SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413502.Ctu_10960 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413502.Ctu_10960
Domain Number 1 Region: 90-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000929
Family NfeD domain-like 0.0084
Further Details:      
 
Weak hits

Sequence:  413502.Ctu_10960
Domain Number - Region: 12-78
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00327
Family Rhomboid-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 413502.Ctu_10960
Sequence length 151
Comment (Cronobacter turicensis)
Sequence
MMTLILSHPHVFWLCLGGLLLAAEMLGGNGFLLWSGVAAVATGLLTWLLPLGWEWQGVSF
ALFMLIAVWLWWRWLSRRAQPRPDNALNQRGQQLIGQRFTLTQALENGRGQITVGDSVWP
VTASSDLPAGTVVEVVALDGIRLRVQASRTQ
Download sequence
Identical sequences C9XXW2
WP_012815600.1.21474 gi|260596888|ref|YP_003209459.1| 413502.Ctu_10960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]