SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413502.Ctu_1p00430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413502.Ctu_1p00430
Domain Number 1 Region: 103-379
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-68
Family D-glucarate dehydratase-like 0.002
Further Details:      
 
Domain Number 2 Region: 10-116
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.13e-29
Family Enolase N-terminal domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 413502.Ctu_1p00430
Sequence length 399
Comment (Cronobacter turicensis)
Sequence
MTPVIIKNIECFITRPDRHNLVTVRVTTDQGVTGHGCATFQQRPLAVKTLVEEYLQPLLT
GRDANNIEDLWQMMNVNAYWRNGPVMNNAISGVDMALWDIKSQLAGMPLYQLFGGKSRDA
IPAYSHASGDTLDALFASVDALIEKGYRHIRCQLGFYGGTASGLHAPENPTPGAWFDQQE
YMSNTVDMFRALREKYGWKLHILHDVHERLFPQQAIQLAKQLEPYQPYFIEDILPPQQSA
WLEQVRQHSCVPLAMGELFNNPSEWHDLIVNRRIDFIRCHVSQIGGITPALKLAHLCQAF
GVRLAWHGPGDMTPVGVAVNTHLNIHLHNAAIQEFIPRSAMTDKIFPGAPEVKDGFIYPP
VNAGIGVGFNEELARAHPVMYRPHEWTQSRLPDGTLHTP
Download sequence
Identical sequences C9Y5D5
WP_012815801.1.21474 gi|260424418|ref|YP_003212619.1| gi|260424418|ref|YP_003212619.1|NC_013283 413502.Ctu_1p00430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]