SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413502.Ctu_22730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413502.Ctu_22730
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.36e-118
Family PFOR PP module 0.0000000203
Further Details:      
 
Domain Number 2 Region: 418-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000155
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.12e-72
Family PFOR Pyr module 0.0000000865
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.43e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000155
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.63e-23
Family Ferredoxin domains from multidomain proteins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 413502.Ctu_22730
Sequence length 1173
Comment (Cronobacter turicensis)
Sequence
MITTDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGMKNVWGDVPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGQLTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIA
PLADDTIRALLPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFAAATGRQYRPFEYYGHPEAERVILLMGSASGTCEEVVDELLTRGEKVGVLKVRL
FRPFSAHHLLAALPHSAQRIAVLDRTKEPGAHAEPLYLDVMTALAEAFNRGERDSLPRVI
GGRYGLSSKEFGPDCVLAVFNELSAAAPKPRFTVGIYDDVTHLSLPLPENTLPSHARLEA
LFYGLGSDGSVSATKNNIKIIGNATPWYAQGYFVYDSKKAGGLTVSHLRVSERPINSAYL
VSQADFVGCHQLQFIDKYPMAERLKPGGIFLINTPYAPDEVWHQLPQEVQAALNNKNARV
FVVNAAKIARECQLGARINTVMQMAFFHLTQILPGDSALQALQGAIAKSYSSKGQELVER
NWQALALARESLFEVARQPVDESSHMRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPLGTTQWEKRNIAEAIPIWKEELCTQCNHCVAACPHSAIRAKVVAPEALADAPGS
LAALDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KRNYDFFLSLPEIDRSTLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHKARVRRL
LAQFADMLSPALFDALQNDATPQARREQVADLRQQLQGVEGAQQLLADADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLSLDSRPPSDALAETLLAEQRFRRLNAQQP
EVAEQLWKDAAADLQKRYDFLAQLAGKAEKVSD
Download sequence
Identical sequences C9Y545
gi|260598065|ref|YP_003210636.1| WP_015741389.1.21474 413502.Ctu_22730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]