SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413997.ECB_00439 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413997.ECB_00439
Domain Number 1 Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000929
Family NfeD domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  413997.ECB_00439
Domain Number - Region: 32-80
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000523
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 413997.ECB_00439
Sequence length 151
Comment (Escherichia coli B REL606)
Sequence
MELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLLPLGWEWQGVMFA
ILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSSW
PVSASEDLGAGTHVEVIAIEGITLHIRAVSS
Download sequence
Identical sequences 413997.ECB_00439 gi|254160557|ref|YP_003043665.1| gi|251783996|ref|YP_002998300.1| gi|251783996|ref|YP_002998300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]