SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413997.ECB_02173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413997.ECB_02173
Domain Number 1 Region: 149-401
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.24e-55
Family D-glucarate dehydratase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.54e-23
Family Enolase N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 413997.ECB_02173
Sequence length 405
Comment (Escherichia coli B REL606)
Sequence
MENIMTLPKIKQVRAWFTGGATAEKGAGGGDYHDQGANHWIDDHIATPMSKYRDYEQSRQ
SFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQML
SATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLA
KEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGEDFWLMLDCWMSQDVNYATKLA
HACAPYNLKWIEECLPPQQYESYRELKRNAPVGMMVTSGEHHGTLQSFRTLSETGIDIMQ
PDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTM
RPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNRDCNLKRPYSH
Download sequence
Identical sequences A0A024L1E7 A0A0E1SW46 A0A1X3JEC6 B1IXU0 B1X8W0 C4ZU89 E3PDU9 F4SGH6 W0FTS6
gi|387612821|ref|YP_006115937.1| WP_000427847.1.100868 WP_000427847.1.11436 WP_000427847.1.14833 WP_000427847.1.153 WP_000427847.1.16715 WP_000427847.1.1755 WP_000427847.1.19889 WP_000427847.1.20151 WP_000427847.1.20943 WP_000427847.1.20982 WP_000427847.1.21057 WP_000427847.1.22632 WP_000427847.1.24089 WP_000427847.1.31379 WP_000427847.1.31833 WP_000427847.1.32509 WP_000427847.1.33545 WP_000427847.1.33648 WP_000427847.1.34990 WP_000427847.1.37233 WP_000427847.1.3815 WP_000427847.1.38211 WP_000427847.1.39367 WP_000427847.1.3980 WP_000427847.1.40912 WP_000427847.1.40965 WP_000427847.1.4670 WP_000427847.1.47048 WP_000427847.1.48048 WP_000427847.1.48080 WP_000427847.1.50078 WP_000427847.1.50452 WP_000427847.1.52492 WP_000427847.1.52558 WP_000427847.1.52844 WP_000427847.1.53327 WP_000427847.1.53377 WP_000427847.1.54602 WP_000427847.1.55529 WP_000427847.1.55574 WP_000427847.1.55608 WP_000427847.1.55868 WP_000427847.1.59407 WP_000427847.1.61949 WP_000427847.1.62099 WP_000427847.1.62735 WP_000427847.1.62840 WP_000427847.1.63478 WP_000427847.1.64749 WP_000427847.1.66050 WP_000427847.1.66700 WP_000427847.1.67022 WP_000427847.1.68215 WP_000427847.1.68283 WP_000427847.1.69258 WP_000427847.1.69303 WP_000427847.1.71229 WP_000427847.1.71312 WP_000427847.1.71480 WP_000427847.1.73835 WP_000427847.1.74445 WP_000427847.1.74520 WP_000427847.1.75149 WP_000427847.1.76196 WP_000427847.1.76909 WP_000427847.1.77648 WP_000427847.1.79871 WP_000427847.1.81054 WP_000427847.1.83097 WP_000427847.1.84210 WP_000427847.1.8444 WP_000427847.1.85857 WP_000427847.1.87574 WP_000427847.1.88434 WP_000427847.1.88834 WP_000427847.1.89468 WP_000427847.1.89899 WP_000427847.1.90078 WP_000427847.1.91462 WP_000427847.1.91551 WP_000427847.1.91739 WP_000427847.1.93276 WP_000427847.1.9457 WP_000427847.1.97123 WP_000427847.1.97418 WP_000427847.1.99265 WP_000427847.1.99453 gi|388478294|ref|YP_490486.1| gi|238901421|ref|YP_002927217.1| gi|254162258|ref|YP_003045366.1| gi|170081865|ref|YP_001731185.1| NYSGXRC-9265c gi|471333953|ref|YP_007557430.1| gi|251785608|ref|YP_002999912.1| gi|251785608|ref|YP_002999912.1| gi|386705508|ref|YP_006169355.1| 316385.ECDH10B_2407 316407.yfaW 413997.ECB_02173 595496.BWG_2020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]