SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413999.CBO0538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413999.CBO0538
Domain Number 1 Region: 86-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000068
Family NfeD domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 413999.CBO0538
Sequence length 146
Comment (Clostridium botulinum A)
Sequence
MWSNFDIIVWIIIGTAALLLDLATSSFLFVWFTLGAIAALIVQILGYSMYIQIIVFTLIS
ILCMILGYPMVKKIIKKQENSILSIERNYVGEIFIADKDIRDEGVLKFQGVYWRVTNSGN
HIKKGDKVKINSVKGNKIFVKKVEEE
Download sequence
Identical sequences A0A0M0A247 A5HZ82
gi|148378540|ref|YP_001253081.1| gi|153931997|ref|YP_001382928.1| 413999.CBO0538 441770.CLB_0578 441771.CLC_0462 gi|153937348|ref|YP_001386357.1| WP_011948280.1.10598 WP_011948280.1.25111 WP_011948280.1.27088 WP_011948280.1.28409 WP_011948280.1.34822 WP_011948280.1.46754 WP_011948280.1.63111 WP_011948280.1.63218 WP_011948280.1.65258 WP_011948280.1.75721 WP_011948280.1.92266 YP_001253081.1.75347 YP_001386357.1.17653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]