SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413999.CBO1192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413999.CBO1192
Domain Number 1 Region: 787-1170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-136
Family PFOR PP module 0.00000000321
Further Details:      
 
Domain Number 2 Region: 415-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.09e-89
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000419
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.47e-80
Family PFOR Pyr module 0.0000000141
Further Details:      
 
Domain Number 4 Region: 259-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.2e-49
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000814
Further Details:      
 
Domain Number 5 Region: 665-832
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.23e-21
Family Ferredoxin domains from multidomain proteins 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 413999.CBO1192
Sequence length 1172
Comment (Clostridium botulinum A)
Sequence
MAKIMKTMDGNQAAAEASYAFTEVAAIYPITPSTPMAEGVDEWSAHGKKNIFGQSVKVVE
MQSEAGASGTVHGSLAAGALTTTYTASQGLLLMIPNLYKIAGELLPGVFHVSARALATHA
LSIFGDHQDVMATRQTGVALLAASNVQEVMDLANIAHLSAIKSRVPFLHFFDGFRTSHEY
QKVETINYDDVAKLVDYDALKEFKSRALNPEHPTLKGTAQNPDIYFQGREASNKFYKEVP
NIVENYMREIEKITGRSYHPFDYYGAPDAENVIVAMGSVCDTIEETVDYLINKGQKVGVI
KIHLYRPFCPTYFMKSLPKTVKKIAVLDRTKEPGSIGEPIYLDVCKVFYNTKDKPIIVGG
RYGLGSKDTRPSQIISVFDNLNQDNPKDGFTIGITDDVTNTSLPEKDIVDTTPEGTINCK
FWGLGSDGTVGANKTAVKIIGDNTDLYAQAYFSYDSKKSGGSTISHLRFGKDKIKSPYLI
YNADYIACHNKSFIYNFDVLKGLKKDGTFVLNCPWDEAELEEKLPASMKRYIAENNINFY
IIDGISIAQNIGLGGRINMIMQSAFFKLANVIPVNEAVELLKNSVEKTYGKKGEKIVEMN
KAAIDTGIDAVHKVNIPSSWKNAEVEPTSIKEEPDFIKKVQRPMSRHEGDELPVSAFNGM
EDGTFPLGTTSYEKRGIAVMIPEWQIDKCIQCNQCSYICPHSVIRAYLLNKDEKEKAPST
FETKKAAGKGLEELGYRIQISPLDCTGCGNCADVCPAPGKALIMKNAEEQIEMQSENWEF
GLNINTKENLMDPKTLKGSQFIRPLLEFHGACPGCGETPYIKLLTQLFGDRMMIANATGC
SSIWGGSAPSIPYTTNSQGKGPSWGNSLFEDNAEYGYGMYLAVKQIREKLAELMQEALNM
EINQDLKDAFKQWLESMDDGEGSKTATAKILEIISNENYQNNPILNEIMEKKDYLIKKSH
WMIGGDGWAYDIGFGGLDHVLASGDDVNIFVMDTEIYSNTGGQCSKSTQTGAIAKFAAAG
KKIKKKDLGLMAMSYGYVYVAQIAMGANMNHTIKTIAEAEAYKGPSLIIAYAPCISHGIK
TGMGTSIAEEKKAVESGYWHLYRYNPMLKGEGKNPFILDSREPTKPFKEFIQGEVRYSSL
MNVFPDIAEKMSDMAEQHARERYDNYRHLADK
Download sequence
Identical sequences A5I130
WP_011948832.1.63111 YP_001253717.1.75347 YP_001387102.1.17653 gi|153936760|ref|YP_001387102.1| gi|148379176|ref|YP_001253717.1| 413999.CBO1192 441770.CLB_1223 441771.CLC_1235 gi|153932884|ref|YP_001383553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]