SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413999.CBO2305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  413999.CBO2305
Domain Number - Region: 193-251
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000575
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 413999.CBO2305
Sequence length 258
Comment (Clostridium botulinum A)
Sequence
MREDEYLRILSKNISNRKMRKEICMEIKNHIMDQKEVYIKIGYSNDDAEKAAIKDMGDPK
ATGKMLDSVHPPTIDWIQIIALIMITLTLQVLKILSELGGSNFSSIAPIDILRILGIFLS
VYALIWIGIEKYSDLPFFYGKSQRGGSNANGVFICSLAIVMMSHSLLQTIIFLLIFAPII
AIERSIIESKRIKKEQKFLWQQGIAYEDFNYKGKAIFNNSPRKVYSQNEPIKKGDPIIIT
KIDGFNLVVEKQDLHNNN
Download sequence
Identical sequences A0A0M0A1B5 A5I474
413999.CBO2305 WP_012047766.1.21778 WP_012047766.1.27088 WP_012047766.1.34822 WP_012047766.1.46754 WP_012047766.1.57120 WP_012047766.1.63111 WP_012047766.1.63218 WP_012047766.1.75721 YP_001254797.1.75347 YP_001388078.2.17653 gi|532643392|ref|YP_001388078.2| gi|148380256|ref|YP_001254797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]