SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 413999.CBO3421 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413999.CBO3421
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 413999.CBO3421
Sequence length 176
Comment (Clostridium botulinum A)
Sequence
MASQQIIFAGFGGQGILSMGKFLAYAGMDANMEVSWLPSYGPEMRGGTANCSVVLSDTPV
GSPIVTKPDTVVVMNRPSLDKFEDMVVPGGLIIIDSDLVDRMPKRDDVKVIAIPAQSEAD
KISSKKIANMILLGALVKETGIVTMDEITASLKDHGKEKFFELNKEALKAGEEYVK
Download sequence
Identical sequences A0A0A2HH82 A0A0E1KXM6 A0A175LRS5 A0A1V9I367 A5I7E6 B1IG09 C1FMP1 M1ZZL0
413999.CBO3421 498213.CLD_1085 536232.CLM_3887 gi|170757210|ref|YP_001783060.1| gi|226950873|ref|YP_002805964.1| gi|387819702|ref|YP_005680049.1| WP_003357379.1.100585 WP_003357379.1.101508 WP_003357379.1.101837 WP_003357379.1.10598 WP_003357379.1.11051 WP_003357379.1.11430 WP_003357379.1.14220 WP_003357379.1.14863 WP_003357379.1.15773 WP_003357379.1.16702 WP_003357379.1.16999 WP_003357379.1.17007 WP_003357379.1.17118 WP_003357379.1.17634 WP_003357379.1.18088 WP_003357379.1.18143 WP_003357379.1.19081 WP_003357379.1.19327 WP_003357379.1.20373 WP_003357379.1.21778 WP_003357379.1.21789 WP_003357379.1.2334 WP_003357379.1.25111 WP_003357379.1.25352 WP_003357379.1.26119 WP_003357379.1.26185 WP_003357379.1.27088 WP_003357379.1.27859 WP_003357379.1.28306 WP_003357379.1.28409 WP_003357379.1.29491 WP_003357379.1.32894 WP_003357379.1.34328 WP_003357379.1.34822 WP_003357379.1.36253 WP_003357379.1.36784 WP_003357379.1.42818 WP_003357379.1.43055 WP_003357379.1.44945 WP_003357379.1.45672 WP_003357379.1.46754 WP_003357379.1.46996 WP_003357379.1.47789 WP_003357379.1.49498 WP_003357379.1.49536 WP_003357379.1.49610 WP_003357379.1.49637 WP_003357379.1.49727 WP_003357379.1.50688 WP_003357379.1.50747 WP_003357379.1.51228 WP_003357379.1.51581 WP_003357379.1.52140 WP_003357379.1.52741 WP_003357379.1.5276 WP_003357379.1.53136 WP_003357379.1.53318 WP_003357379.1.56340 WP_003357379.1.5655 WP_003357379.1.57003 WP_003357379.1.57050 WP_003357379.1.57120 WP_003357379.1.57916 WP_003357379.1.59839 WP_003357379.1.59927 WP_003357379.1.61167 WP_003357379.1.63039 WP_003357379.1.63111 WP_003357379.1.63218 WP_003357379.1.64959 WP_003357379.1.65258 WP_003357379.1.65534 WP_003357379.1.65765 WP_003357379.1.66957 WP_003357379.1.67470 WP_003357379.1.67940 WP_003357379.1.68124 WP_003357379.1.69035 WP_003357379.1.69463 WP_003357379.1.69692 WP_003357379.1.70928 WP_003357379.1.716 WP_003357379.1.73124 WP_003357379.1.74799 WP_003357379.1.75721 WP_003357379.1.76938 WP_003357379.1.77051 WP_003357379.1.78559 WP_003357379.1.79827 WP_003357379.1.80383 WP_003357379.1.80865 WP_003357379.1.83422 WP_003357379.1.8456 WP_003357379.1.87449 WP_003357379.1.87856 WP_003357379.1.88000 WP_003357379.1.90975 WP_003357379.1.9205 WP_003357379.1.92266 WP_003357379.1.93232 WP_003357379.1.93526 WP_003357379.1.94833 WP_003357379.1.95223 WP_003357379.1.95482 WP_003357379.1.95863 WP_003357379.1.9587 WP_003357379.1.96382 WP_003357379.1.96416 WP_003357379.1.96493 WP_003357379.1.96844 WP_003357379.1.97020 WP_003357379.1.9927 WP_003357379.1.99682 YP_001255902.1.75347 YP_008472700.1.17653 gi|532643414|ref|YP_008472700.1| gi|148381361|ref|YP_001255902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]