SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 41431.PCC8801_1569 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41431.PCC8801_1569
Domain Number 1 Region: 10-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 41431.PCC8801_1569
Sequence length 332
Comment (Cyanothece PCC 8801)
Sequence
MTTQTPETDFPIVIVNNYPVMQMPPRLTILEAVTFKKVCHHFLGKSPLPSQLIIDFSQTQ
FMDSSGVGALVHNYKSAKNKNVQLILYNIHPPVMAVLSMTGLDEVFPITLSLDTQQKTTA
SSIREHPPETHPSVRSWIKRLIDIVGSLIGLVITGFLFIPIAIAIKHDSSGPIFFQQIRC
GWLGKRFKIIKFRSMCVDAEAQKHKIPNQAQGAIFKNPNDPRITKVGKFLRRTSLDELPQ
FWNVLKGDMSLVGTRPPTPDEVERYEVPQWQRLNVKPGMTGEWQVYGRSRVKDFEEVIKL
DLRYQENWSHWYDLQLIFRTILILFRKNSGAF
Download sequence
Identical sequences B7JUS7
WP_012594894.1.62203 WP_012594894.1.93053 gi|218246406|ref|YP_002371777.1| 395962.Cyan8802_1592 41431.PCC8801_1569 gi|257059448|ref|YP_003137336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]