SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 41431.PCC8801_3918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41431.PCC8801_3918
Domain Number 1 Region: 800-1193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.66e-126
Family PFOR PP module 0.0000000183
Further Details:      
 
Domain Number 2 Region: 420-672
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.02e-82
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000309
Further Details:      
 
Domain Number 3 Region: 5-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.77e-76
Family PFOR Pyr module 0.0000000641
Further Details:      
 
Domain Number 4 Region: 260-418
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.4e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000577
Further Details:      
 
Domain Number 5 Region: 669-845
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.53e-24
Family Ferredoxin domains from multidomain proteins 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 41431.PCC8801_3918
Sequence length 1212
Comment (Cyanothece PCC 8801)
Sequence
MNAKTYATIDGNEAVARVAYRLNEVIAIYPITPSSPMGEWADAWCSEGRTNLWGTVPSIV
EMQSEGGAAGAIHGSLQTGSLTTTFTASQGLLLMIPNLYKIAGELTATVIHVAARSLAAQ
GLSIFGDHGDVMAARSTGFALISSASVQEAQDLAAITTAASFESRVPGMHFFDGFRTSHE
VQKVELLDDSVLRSLIQDEWVIAHRDRALTPDRPVIRGTAQNPDVYFQARETVNPFYTAY
PEILQKAMDKFAQLTGRQYHLFDYHGHPEAERVIILMGSGCETVHETVDYLLSQGEKVGV
LKVRLYRPFEATKLIEALPKTLKKIAVLDRTKEPGSAGEPLYLDVVTAFVEAFHEMPLPK
IVGGRYGLSSKEFTSAMVKGIFDNLTLDNPKNHFTIGIKDDVSHTSINYDPNFSTEPDNV
VRAIFYGLGSDGTVGANKNSIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGPNPIQS
TYLVTKANFIACHQWEFVEKFDLLESAIDGSTLLLNSPYKPEEIWHHFPRSMQEQMINKH
LKVHTINAYEVAKNAGMGGRINTVMQVCFFALSGVLPRDEAIEQIKKAIRKTYGKKGEEI
VQMNMKAVDASLDHLHEITIPTAVDKDASEISHPIPDRAPAFVRDVLGKMLARQGDEIPV
SALPCDGTYPSGTAKWEKRNVTQEIPVWDPDVCIQCGKCVLVCPHAVIRSKVYEETALVN
APETFKTASAKDLDWKKTALKFTIQVAAEDCTGCGVCVDVCPAKNKSQPKLKAINMAPQL
PIRDQERENWDYFLSIANPDRNTLKLNKISHQQMQEPLFEFSGACAGCGETPYIKLATQL
FGDRMVVANATGCSSIYGGNLPTTPWSYNQEGRGPAWSNSLFEDNAEFGLGFRVSIDKQA
EFAAELLKSLASEVGDSLATAILTAHQTDEADIFEQREQVAILKQRLAELSNSNLDDSIQ
AKVTMLKSLADYLVKKSVWIIGGDGWAYDIGYGGLDHVLASGRNVNILVMDTEVYSNTGG
QASKATPRAAVAKFAAGGKASPKKDLGLMAMTYGNVYVASVAMGAKNEQTIKAFLEAEAY
QGVSLIIAYSHCIAHGINMTTAMSYQKEIVDSGRWLLYRYHPDLILQGKNPLQLDMGRPK
LPIEQTMYQENRFKMLARSKPDAAKKLLKEAQEDVNTRWKMYQYLAARQLETGNGNGHSK
ATVQSETSVSEV
Download sequence
Identical sequences B7K538
41431.PCC8801_3918 gi|218248649|ref|YP_002374020.1| WP_012597119.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]