SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 41431.PCC8801_4156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41431.PCC8801_4156
Domain Number 1 Region: 41-131
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.84e-26
Family Pentapeptide repeats 0.001
Further Details:      
 
Domain Number 2 Region: 138-204
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000987
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 41431.PCC8801_4156
Sequence length 261
Comment (Cyanothece PCC 8801)
Sequence
MKAIIATTTAILTAFSFSMAAKAENLEHLNRLLSTKQCPLCDLSGAGLVMVDLSGAKLIG
ANLAGANLSQANLSGADLSGANLSGASLHGANLIGANLSSAILNGTDLREAYLSNAIIVG
TKLDAAYVQGAEGIPNNAGTRELFYEWGLIETKQGNYQKALDHYNKALLMDAEYAPVYLA
RAYALLRLGNEAGATENAAIASQLFAKQENPQGQEMSDTFVKNLETFQEVRKKEKEGNNA
QLDNFVRGAASLMLRLFLGGM
Download sequence
Identical sequences B7K635
gi|257061935|ref|YP_003139823.1| gi|218248873|ref|YP_002374244.1| 395962.Cyan8802_4196 41431.PCC8801_4156 WP_015785139.1.62203 WP_015785139.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]