SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 414684.RC1_1771 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  414684.RC1_1771
Domain Number - Region: 90-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000209
Family NfeD domain-like 0.0089
Further Details:      
 
Domain Number - Region: 8-83
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00392
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 414684.RC1_1771
Sequence length 149
Comment (Rhodospirillum centenum SW)
Sequence
MEGVRIVFWHWWVAAVLLGLLEMFVPGAALIWLGLAAGVVGLTLLVLPDLSWQVQFGAFA
VIAIAAVAASRFVPTRRLEETDQPTLNRRAEQYLGRTLRLETAIVNGRGRAYVGDSLWTV
AGVEDLPQDTAVRVVGVDGALLRVERAPG
Download sequence
Identical sequences B6ITF0
gi|209965066|ref|YP_002297981.1| 414684.RC1_1771 WP_012566953.1.40880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]