SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 41514.SARI_00001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41514.SARI_00001
Domain Number 1 Region: 138-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.53e-83
Family D-glucarate dehydratase-like 0.00000000358
Further Details:      
 
Domain Number 2 Region: 7-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.04e-31
Family Enolase N-terminal domain-like 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 41514.SARI_00001
Sequence length 446
Comment (Salmonella enterica arizonae serovar 62 z4 z23 )
Sequence
MTRQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGVGEAPGGEVI
YQTLVDAIPMVLGQEVARLNSVVQRVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGQALNVPVCELLGPGKQRDAVTVLGYLFYIGDRTKTELPYLESTPGSHEWYRLRHQE
ALNSDTVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAIALCKGLNDVLAYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGK
PTAIDTHWIWQEGDCRLTKNPLEIKNGTIAVPDAPGLGVELDWEQVRKAHDAYKKLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
Download sequence
Identical sequences A9MEG1
gi|161501985|ref|YP_001569097.1| CP000880|CDS_978-2318 WP_012209826.1.90617 41514.SARI_00001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]