SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 41514.SARI_00009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41514.SARI_00009
Domain Number 1 Region: 143-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.93e-129
Family Enolase 0.000000000114
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.57e-56
Family Enolase N-terminal domain-like 0.000000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 41514.SARI_00009
Sequence length 432
Comment (Salmonella enterica arizonae serovar 62 z4 z23 )
Sequence
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVGAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKSNFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK
EAIRMGSEVFHHLAKVLKGKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGRKEIKGQA
Download sequence
Identical sequences A0A089G7P7 A0A0F5B9D6 A0A0F6B623 A0A0F7J9X8 A0A0G2NR47 A0A0H3NLM4 A0A0J5LR73 A0A0K0HE23 A0A0L9EAV8 A0A0M0QVJ6 A0A0R9MHN3 A0A0T7RSA5 A0A0U1IAS7 A0A0V2E596 A0A1C2ZY25 A0A1J7LJ02 A0A1M3Y8W5 A0A1S0ZI19 A0A1S1ANB5 A0A1X2RLM4 A0A1X2T594 A0A1X2TIG1 A0A1X2V0N8 A0A1X2Y7J6 A0A1Z3Q620 A0A221YPV2 A0A221Z9F4 A0A248K6B4 A0A265BCI6 A0A267S8E2 A0A271CNT5 A0A271CX24 A0A2C6FMN8 A0A2C9NW49 A0A2D1XAT6 A0A2D1XND3 A0A2D3AFT3 A0A2D3TSC5 A0A2G1P1K9 A0A2H9YFG1 A0A2I5HD19 A0A2I6M4H8 A0A2I6MI10 A0A2I6MVX1 A0A2I6N9W7 A0A2I6NMP2 A0A2I6P0J4 A0A2K2S388 A0A2K2S5Z9 A0A2K2SHS1 A0A2K2T744 A0A2K2TDX9 A0A2K2ZN26 A9MF11 A9N2F4 B4T483 B4TFZ1 B4TTY5 B5BF02 B5F4N9 B5QW40 B5RDS5 C0PXD5 E8X8N5 G4C6C6 G5LCA3 G5LT03 G5NHH1 G5PS44 G5Q768 G5QNU8 G5R4S7 G5RJV9 G5RZW9 G5SG67 P64076 P64077 Q57KH0 Q5PEH4 S4ICG8 S5HP81 S5MTU3 V1GT24 V1WZV3 V7IIN0 V7U8U5
gi|525837154|ref|YP_008253872.1| gi|386592636|ref|YP_006089036.1| gi|537438140|ref|YP_008482517.1| gi|224584736|ref|YP_002638534.1| gi|563654297|ref|YP_008862381.1| gi|525814215|ref|YP_008244233.1| gi|378961020|ref|YP_005218506.1| NP_457341.1.84458 NP_461873.1.58477 WP_000036734.1.100002 WP_000036734.1.100007 WP_000036734.1.100008 WP_000036734.1.100010 WP_000036734.1.100031 WP_000036734.1.100036 WP_000036734.1.100077 WP_000036734.1.100079 WP_000036734.1.100115 WP_000036734.1.100129 WP_000036734.1.10013 WP_000036734.1.100137 WP_000036734.1.100149 WP_000036734.1.100165 WP_000036734.1.100191 WP_000036734.1.100196 WP_000036734.1.1002 WP_000036734.1.100234 WP_000036734.1.100258 WP_000036734.1.100266 WP_000036734.1.100284 WP_000036734.1.100288 WP_000036734.1.100313 WP_000036734.1.100314 WP_000036734.1.100321 WP_000036734.1.100354 WP_000036734.1.100376 WP_000036734.1.100392 WP_000036734.1.100412 WP_000036734.1.100413 WP_000036734.1.100421 WP_000036734.1.100424 WP_000036734.1.100432 WP_000036734.1.100436 WP_000036734.1.100438 WP_000036734.1.100446 WP_000036734.1.100450 WP_000036734.1.100457 WP_000036734.1.100472 WP_000036734.1.100484 WP_000036734.1.100488 WP_000036734.1.100502 WP_000036734.1.100521 WP_000036734.1.100541 WP_000036734.1.100557 WP_000036734.1.100584 WP_000036734.1.100589 WP_000036734.1.100592 WP_000036734.1.100597 WP_000036734.1.100605 WP_000036734.1.100610 WP_000036734.1.100642 WP_000036734.1.10065 WP_000036734.1.100650 WP_000036734.1.100707 WP_000036734.1.100711 WP_000036734.1.100714 WP_000036734.1.100721 WP_000036734.1.100730 WP_000036734.1.100732 WP_000036734.1.100733 WP_000036734.1.100739 WP_000036734.1.10074 WP_000036734.1.100750 WP_000036734.1.10076 WP_000036734.1.100764 WP_000036734.1.100773 WP_000036734.1.100776 WP_000036734.1.100781 WP_000036734.1.100790 WP_000036734.1.100793 WP_000036734.1.100799 WP_000036734.1.10081 WP_000036734.1.100857 WP_000036734.1.100865 WP_000036734.1.100869 WP_000036734.1.100870 WP_000036734.1.100871 WP_000036734.1.100882 WP_000036734.1.100886 WP_000036734.1.100895 WP_000036734.1.100932 WP_000036734.1.100941 WP_000036734.1.100944 WP_000036734.1.100948 WP_000036734.1.100953 WP_000036734.1.100979 WP_000036734.1.101007 WP_000036734.1.101011 WP_000036734.1.101020 WP_000036734.1.101042 WP_000036734.1.101074 WP_000036734.1.101078 WP_000036734.1.10108 WP_000036734.1.101091 WP_000036734.1.101094 WP_000036734.1.101111 WP_000036734.1.101112 WP_000036734.1.101123 WP_000036734.1.101126 WP_000036734.1.101147 WP_000036734.1.101180 WP_000036734.1.101185 WP_000036734.1.101199 WP_000036734.1.101223 WP_000036734.1.101226 WP_000036734.1.101239 WP_000036734.1.10124 WP_000036734.1.101259 WP_000036734.1.101271 WP_000036734.1.101284 WP_000036734.1.101291 WP_000036734.1.1013 WP_000036734.1.101312 WP_000036734.1.101320 WP_000036734.1.101322 WP_000036734.1.101353 WP_000036734.1.101363 WP_000036734.1.101374 WP_000036734.1.101386 WP_000036734.1.101404 WP_000036734.1.101420 WP_000036734.1.101425 WP_000036734.1.101454 WP_000036734.1.101473 WP_000036734.1.101519 WP_000036734.1.101520 WP_000036734.1.101541 WP_000036734.1.101543 WP_000036734.1.101589 WP_000036734.1.101609 WP_000036734.1.101612 WP_000036734.1.101616 WP_000036734.1.101634 WP_000036734.1.101636 WP_000036734.1.101639 WP_000036734.1.10164 WP_000036734.1.101666 WP_000036734.1.101674 WP_000036734.1.101707 WP_000036734.1.101724 WP_000036734.1.101734 WP_000036734.1.101740 WP_000036734.1.101741 WP_000036734.1.101744 WP_000036734.1.101759 WP_000036734.1.101815 WP_000036734.1.101832 WP_000036734.1.101839 WP_000036734.1.101841 WP_000036734.1.101868 WP_000036734.1.101878 WP_000036734.1.101890 WP_000036734.1.101904 WP_000036734.1.10191 WP_000036734.1.101917 WP_000036734.1.101941 WP_000036734.1.101949 WP_000036734.1.101953 WP_000036734.1.101975 WP_000036734.1.102009 WP_000036734.1.102050 WP_000036734.1.102087 WP_000036734.1.102111 WP_000036734.1.10220 WP_000036734.1.10231 WP_000036734.1.10237 WP_000036734.1.10266 WP_000036734.1.10276 WP_000036734.1.10293 WP_000036734.1.10300 WP_000036734.1.10310 WP_000036734.1.10338 WP_000036734.1.1038 WP_000036734.1.10394 WP_000036734.1.104 WP_000036734.1.10401 WP_000036734.1.10428 WP_000036734.1.10439 WP_000036734.1.10459 WP_000036734.1.10463 WP_000036734.1.10465 WP_000036734.1.10475 WP_000036734.1.10498 WP_000036734.1.10507 WP_000036734.1.10511 WP_000036734.1.10514 WP_000036734.1.10521 WP_000036734.1.10530 WP_000036734.1.10532 WP_000036734.1.10547 WP_000036734.1.10562 WP_000036734.1.10566 WP_000036734.1.10568 WP_000036734.1.10595 WP_000036734.1.106 WP_000036734.1.10631 WP_000036734.1.10642 WP_000036734.1.10654 WP_000036734.1.10675 WP_000036734.1.10677 WP_000036734.1.10678 WP_000036734.1.10711 WP_000036734.1.10720 WP_000036734.1.10753 WP_000036734.1.10755 WP_000036734.1.10797 WP_000036734.1.10857 WP_000036734.1.10868 WP_000036734.1.10873 WP_000036734.1.10898 WP_000036734.1.10926 WP_000036734.1.10936 WP_000036734.1.10992 WP_000036734.1.11000 WP_000036734.1.11012 WP_000036734.1.11024 WP_000036734.1.11031 WP_000036734.1.11041 WP_000036734.1.11055 WP_000036734.1.11098 WP_000036734.1.1110 WP_000036734.1.11119 WP_000036734.1.11126 WP_000036734.1.11142 WP_000036734.1.11156 WP_000036734.1.11168 WP_000036734.1.11190 WP_000036734.1.11213 WP_000036734.1.11216 WP_000036734.1.11239 WP_000036734.1.11253 WP_000036734.1.11254 WP_000036734.1.11295 WP_000036734.1.113 WP_000036734.1.11304 WP_000036734.1.11314 WP_000036734.1.1135 WP_000036734.1.11362 WP_000036734.1.11369 WP_000036734.1.1137 WP_000036734.1.11385 WP_000036734.1.11386 WP_000036734.1.11405 WP_000036734.1.1142 WP_000036734.1.11426 WP_000036734.1.11429 WP_000036734.1.11444 WP_000036734.1.11455 WP_000036734.1.11458 WP_000036734.1.11479 WP_000036734.1.1150 WP_000036734.1.11511 WP_000036734.1.11518 WP_000036734.1.11526 WP_000036734.1.11528 WP_000036734.1.11532 WP_000036734.1.11543 WP_000036734.1.11544 WP_000036734.1.11557 WP_000036734.1.1156 WP_000036734.1.11565 WP_000036734.1.11567 WP_000036734.1.11588 WP_000036734.1.11603 WP_000036734.1.11621 WP_000036734.1.11638 WP_000036734.1.11677 WP_000036734.1.11681 WP_000036734.1.11687 WP_000036734.1.1169 WP_000036734.1.11735 WP_000036734.1.1174 WP_000036734.1.11763 WP_000036734.1.11772 WP_000036734.1.11810 WP_000036734.1.11824 WP_000036734.1.11834 WP_000036734.1.11841 WP_000036734.1.11865 WP_000036734.1.11868 WP_000036734.1.11875 WP_000036734.1.11883 WP_000036734.1.11897 WP_000036734.1.11900 WP_000036734.1.11908 WP_000036734.1.11914 WP_000036734.1.11936 WP_000036734.1.11938 WP_000036734.1.11964 WP_000036734.1.11978 WP_000036734.1.12007 WP_000036734.1.12017 WP_000036734.1.12025 WP_000036734.1.12027 WP_000036734.1.1204 WP_000036734.1.12040 WP_000036734.1.12047 WP_000036734.1.12059 WP_000036734.1.12061 WP_000036734.1.12063 WP_000036734.1.1207 WP_000036734.1.12106 WP_000036734.1.12114 WP_000036734.1.12141 WP_000036734.1.12144 WP_000036734.1.1215 WP_000036734.1.12159 WP_000036734.1.12160 WP_000036734.1.12168 WP_000036734.1.12172 WP_000036734.1.12192 WP_000036734.1.12210 WP_000036734.1.1224 WP_000036734.1.12244 WP_000036734.1.12280 WP_000036734.1.12282 WP_000036734.1.12308 WP_000036734.1.12340 WP_000036734.1.12351 WP_000036734.1.12364 WP_000036734.1.12370 WP_000036734.1.12374 WP_000036734.1.12396 WP_000036734.1.12397 WP_000036734.1.12398 WP_000036734.1.12441 WP_000036734.1.12456 WP_000036734.1.1246 WP_000036734.1.12472 WP_000036734.1.12484 WP_000036734.1.12485 WP_000036734.1.1250 WP_000036734.1.12517 WP_000036734.1.12546 WP_000036734.1.12568 WP_000036734.1.12569 WP_000036734.1.12581 WP_000036734.1.12584 WP_000036734.1.12585 WP_000036734.1.12620 WP_000036734.1.1264 WP_000036734.1.12648 WP_000036734.1.12650 WP_000036734.1.12683 WP_000036734.1.12696 WP_000036734.1.12701 WP_000036734.1.12718 WP_000036734.1.12726 WP_000036734.1.12727 WP_000036734.1.12728 WP_000036734.1.12741 WP_000036734.1.12834 WP_000036734.1.12864 WP_000036734.1.12865 WP_000036734.1.12877 WP_000036734.1.12879 WP_000036734.1.12936 WP_000036734.1.1299 WP_000036734.1.12995 WP_000036734.1.1300 WP_000036734.1.13027 WP_000036734.1.13076 WP_000036734.1.13101 WP_000036734.1.13102 WP_000036734.1.13106 WP_000036734.1.13108 WP_000036734.1.13130 WP_000036734.1.13161 WP_000036734.1.13207 WP_000036734.1.1321 WP_000036734.1.13247 WP_000036734.1.1326 WP_000036734.1.13262 WP_000036734.1.13268 WP_000036734.1.13274 WP_000036734.1.13291 WP_000036734.1.133 WP_000036734.1.13311 WP_000036734.1.13314 WP_000036734.1.13334 WP_000036734.1.13338 WP_000036734.1.13342 WP_000036734.1.13352 WP_000036734.1.13367 WP_000036734.1.13391 WP_000036734.1.13406 WP_000036734.1.13414 WP_000036734.1.13429 WP_000036734.1.13440 WP_000036734.1.13443 WP_000036734.1.13446 WP_000036734.1.1346 WP_000036734.1.13465 WP_000036734.1.13476 WP_000036734.1.13488 WP_000036734.1.13509 WP_000036734.1.13528 WP_000036734.1.13543 WP_000036734.1.13573 WP_000036734.1.13599 WP_000036734.1.13602 WP_000036734.1.13625 WP_000036734.1.13661 WP_000036734.1.13669 WP_000036734.1.13677 WP_000036734.1.13686 WP_000036734.1.13691 WP_000036734.1.1372 WP_000036734.1.13732 WP_000036734.1.13741 WP_000036734.1.13750 WP_000036734.1.13764 WP_000036734.1.13799 WP_000036734.1.13812 WP_000036734.1.13819 WP_000036734.1.1382 WP_000036734.1.13827 WP_000036734.1.13829 WP_000036734.1.13848 WP_000036734.1.13857 WP_000036734.1.1387 WP_000036734.1.13908 WP_000036734.1.13932 WP_000036734.1.13967 WP_000036734.1.13968 WP_000036734.1.1397 WP_000036734.1.13972 WP_000036734.1.13980 WP_000036734.1.140 WP_000036734.1.14001 WP_000036734.1.1401 WP_000036734.1.14011 WP_000036734.1.14041 WP_000036734.1.14050 WP_000036734.1.14056 WP_000036734.1.1408 WP_000036734.1.14089 WP_000036734.1.14099 WP_000036734.1.14111 WP_000036734.1.1412 WP_000036734.1.14120 WP_000036734.1.14123 WP_000036734.1.14150 WP_000036734.1.14151 WP_000036734.1.14191 WP_000036734.1.14197 WP_000036734.1.14212 WP_000036734.1.14239 WP_000036734.1.14280 WP_000036734.1.14286 WP_000036734.1.14296 WP_000036734.1.14320 WP_000036734.1.14333 WP_000036734.1.14369 WP_000036734.1.14379 WP_000036734.1.14399 WP_000036734.1.1440 WP_000036734.1.14406 WP_000036734.1.14410 WP_000036734.1.14436 WP_000036734.1.14444 WP_000036734.1.14446 WP_000036734.1.14458 WP_000036734.1.14466 WP_000036734.1.14467 WP_000036734.1.14474 WP_000036734.1.14495 WP_000036734.1.14500 WP_000036734.1.14505 WP_000036734.1.14516 WP_000036734.1.14519 WP_000036734.1.14524 WP_000036734.1.14526 WP_000036734.1.14528 WP_000036734.1.14550 WP_000036734.1.14554 WP_000036734.1.14575 WP_000036734.1.146 WP_000036734.1.14618 WP_000036734.1.14688 WP_000036734.1.14701 WP_000036734.1.14703 WP_000036734.1.14706 WP_000036734.1.14708 WP_000036734.1.14719 WP_000036734.1.14725 WP_000036734.1.1473 WP_000036734.1.14737 WP_000036734.1.14765 WP_000036734.1.14789 WP_000036734.1.14793 WP_000036734.1.14808 WP_000036734.1.14810 WP_000036734.1.14819 WP_000036734.1.14852 WP_000036734.1.14876 WP_000036734.1.14877 WP_000036734.1.14884 WP_000036734.1.1489 WP_000036734.1.14894 WP_000036734.1.14913 WP_000036734.1.14917 WP_000036734.1.14927 WP_000036734.1.14930 WP_000036734.1.14932 WP_000036734.1.14936 WP_000036734.1.14947 WP_000036734.1.14948 WP_000036734.1.14964 WP_000036734.1.15011 WP_000036734.1.15046 WP_000036734.1.15054 WP_000036734.1.15055 WP_000036734.1.15059 WP_000036734.1.15067 WP_000036734.1.15079 WP_000036734.1.15100 WP_000036734.1.15102 WP_000036734.1.15124 WP_000036734.1.15184 WP_000036734.1.15223 WP_000036734.1.15226 WP_000036734.1.15244 WP_000036734.1.15265 WP_000036734.1.15276 WP_000036734.1.15316 WP_000036734.1.15318 WP_000036734.1.15353 WP_000036734.1.15362 WP_000036734.1.15369 WP_000036734.1.1540 WP_000036734.1.15415 WP_000036734.1.15423 WP_000036734.1.15433 WP_000036734.1.15439 WP_000036734.1.15468 WP_000036734.1.15479 WP_000036734.1.15483 WP_000036734.1.15487 WP_000036734.1.15508 WP_000036734.1.1551 WP_000036734.1.15535 WP_000036734.1.15581 WP_000036734.1.15585 WP_000036734.1.15586 WP_000036734.1.15597 WP_000036734.1.15612 WP_000036734.1.15616 WP_000036734.1.15625 WP_000036734.1.15627 WP_000036734.1.15637 WP_000036734.1.15644 WP_000036734.1.1568 WP_000036734.1.15708 WP_000036734.1.15710 WP_000036734.1.15717 WP_000036734.1.15775 WP_000036734.1.15777 WP_000036734.1.15795 WP_000036734.1.158 WP_000036734.1.15830 WP_000036734.1.15835 WP_000036734.1.15862 WP_000036734.1.15881 WP_000036734.1.15905 WP_000036734.1.15909 WP_000036734.1.15910 WP_000036734.1.15912 WP_000036734.1.1592 WP_000036734.1.15922 WP_000036734.1.15938 WP_000036734.1.15944 WP_000036734.1.15970 WP_000036734.1.15978 WP_000036734.1.15986 WP_000036734.1.15995 WP_000036734.1.16000 WP_000036734.1.16004 WP_000036734.1.16006 WP_000036734.1.1601 WP_000036734.1.16028 WP_000036734.1.16032 WP_000036734.1.16046 WP_000036734.1.16047 WP_000036734.1.16051 WP_000036734.1.16052 WP_000036734.1.16058 WP_000036734.1.16062 WP_000036734.1.16063 WP_000036734.1.16103 WP_000036734.1.1611 WP_000036734.1.16125 WP_000036734.1.16150 WP_000036734.1.16155 WP_000036734.1.16158 WP_000036734.1.16166 WP_000036734.1.16172 WP_000036734.1.16201 WP_000036734.1.16226 WP_000036734.1.16233 WP_000036734.1.16244 WP_000036734.1.1626 WP_000036734.1.16264 WP_000036734.1.16273 WP_000036734.1.16284 WP_000036734.1.16328 WP_000036734.1.16331 WP_000036734.1.16344 WP_000036734.1.16347 WP_000036734.1.1635 WP_000036734.1.16361 WP_000036734.1.16363 WP_000036734.1.16365 WP_000036734.1.16366 WP_000036734.1.16394 WP_000036734.1.16452 WP_000036734.1.16453 WP_000036734.1.16461 WP_000036734.1.16462 WP_000036734.1.16465 WP_000036734.1.16468 WP_000036734.1.16474 WP_000036734.1.16508 WP_000036734.1.16522 WP_000036734.1.16525 WP_000036734.1.16551 WP_000036734.1.16565 WP_000036734.1.16581 WP_000036734.1.16588 WP_000036734.1.16614 WP_000036734.1.16650 WP_000036734.1.16656 WP_000036734.1.16658 WP_000036734.1.16666 WP_000036734.1.16673 WP_000036734.1.16686 WP_000036734.1.16691 WP_000036734.1.167 WP_000036734.1.16704 WP_000036734.1.16710 WP_000036734.1.16729 WP_000036734.1.16732 WP_000036734.1.16735 WP_000036734.1.16736 WP_000036734.1.1674 WP_000036734.1.16767 WP_000036734.1.16781 WP_000036734.1.16786 WP_000036734.1.16804 WP_000036734.1.16817 WP_000036734.1.16819 WP_000036734.1.16826 WP_000036734.1.16846 WP_000036734.1.16855 WP_000036734.1.16858 WP_000036734.1.16873 WP_000036734.1.16879 WP_000036734.1.1689 WP_000036734.1.16893 WP_000036734.1.16896 WP_000036734.1.16903 WP_000036734.1.16905 WP_000036734.1.16910 WP_000036734.1.16916 WP_000036734.1.16941 WP_000036734.1.16942 WP_000036734.1.16944 WP_000036734.1.16948 WP_000036734.1.16949 WP_000036734.1.16965 WP_000036734.1.16972 WP_000036734.1.16998 WP_000036734.1.1700 WP_000036734.1.17031 WP_000036734.1.17049 WP_000036734.1.17058 WP_000036734.1.17060 WP_000036734.1.17078 WP_000036734.1.17093 WP_000036734.1.17096 WP_000036734.1.17098 WP_000036734.1.17105 WP_000036734.1.17188 WP_000036734.1.17202 WP_000036734.1.17219 WP_000036734.1.1722 WP_000036734.1.17270 WP_000036734.1.17285 WP_000036734.1.17302 WP_000036734.1.17307 WP_000036734.1.17308 WP_000036734.1.1733 WP_000036734.1.17368 WP_000036734.1.1737 WP_000036734.1.17390 WP_000036734.1.174 WP_000036734.1.17405 WP_000036734.1.17406 WP_000036734.1.17439 WP_000036734.1.17447 WP_000036734.1.17480 WP_000036734.1.17482 WP_000036734.1.1749 WP_000036734.1.17504 WP_000036734.1.17513 WP_000036734.1.17525 WP_000036734.1.17543 WP_000036734.1.17546 WP_000036734.1.17560 WP_000036734.1.17563 WP_000036734.1.1757 WP_000036734.1.17578 WP_000036734.1.17583 WP_000036734.1.17622 WP_000036734.1.17629 WP_000036734.1.17659 WP_000036734.1.17667 WP_000036734.1.17686 WP_000036734.1.17693 WP_000036734.1.17694 WP_000036734.1.17702 WP_000036734.1.17703 WP_000036734.1.17705 WP_000036734.1.17732 WP_000036734.1.17741 WP_000036734.1.17743 WP_000036734.1.17747 WP_000036734.1.17755 WP_000036734.1.17758 WP_000036734.1.17840 WP_000036734.1.17865 WP_000036734.1.17886 WP_000036734.1.17891 WP_000036734.1.17901 WP_000036734.1.17914 WP_000036734.1.17919 WP_000036734.1.17936 WP_000036734.1.17949 WP_000036734.1.17956 WP_000036734.1.1798 WP_000036734.1.17991 WP_000036734.1.18005 WP_000036734.1.1801 WP_000036734.1.18019 WP_000036734.1.18021 WP_000036734.1.18022 WP_000036734.1.18056 WP_000036734.1.18061 WP_000036734.1.1807 WP_000036734.1.18089 WP_000036734.1.18092 WP_000036734.1.18099 WP_000036734.1.18103 WP_000036734.1.18109 WP_000036734.1.18111 WP_000036734.1.18122 WP_000036734.1.18124 WP_000036734.1.1814 WP_000036734.1.18144 WP_000036734.1.18149 WP_000036734.1.18163 WP_000036734.1.18173 WP_000036734.1.18177 WP_000036734.1.18178 WP_000036734.1.1818 WP_000036734.1.18192 WP_000036734.1.18249 WP_000036734.1.1825 WP_000036734.1.18254 WP_000036734.1.18265 WP_000036734.1.18267 WP_000036734.1.18270 WP_000036734.1.18277 WP_000036734.1.18280 WP_000036734.1.18281 WP_000036734.1.18282 WP_000036734.1.1832 WP_000036734.1.18328 WP_000036734.1.18355 WP_000036734.1.18358 WP_000036734.1.18365 WP_000036734.1.18370 WP_000036734.1.18384 WP_000036734.1.18406 WP_000036734.1.18426 WP_000036734.1.18441 WP_000036734.1.18445 WP_000036734.1.18468 WP_000036734.1.18474 WP_000036734.1.18483 WP_000036734.1.18485 WP_000036734.1.18489 WP_000036734.1.18513 WP_000036734.1.18607 WP_000036734.1.18610 WP_000036734.1.18641 WP_000036734.1.18678 WP_000036734.1.18686 WP_000036734.1.18692 WP_000036734.1.18715 WP_000036734.1.18722 WP_000036734.1.18737 WP_000036734.1.18766 WP_000036734.1.18776 WP_000036734.1.18796 WP_000036734.1.1880 WP_000036734.1.18822 WP_000036734.1.18847 WP_000036734.1.1885 WP_000036734.1.18860 WP_000036734.1.18881 WP_000036734.1.18886 WP_000036734.1.18895 WP_000036734.1.18919 WP_000036734.1.18922 WP_000036734.1.18940 WP_000036734.1.18949 WP_000036734.1.1895 WP_000036734.1.18959 WP_000036734.1.1897 WP_000036734.1.18972 WP_000036734.1.19001 WP_000036734.1.19006 WP_000036734.1.19030 WP_000036734.1.19038 WP_000036734.1.19044 WP_000036734.1.19053 WP_000036734.1.19064 WP_000036734.1.19084 WP_000036734.1.19093 WP_000036734.1.19163 WP_000036734.1.19174 WP_000036734.1.19187 WP_000036734.1.19228 WP_000036734.1.19240 WP_000036734.1.19273 WP_000036734.1.19288 WP_000036734.1.19291 WP_000036734.1.19300 WP_000036734.1.19320 WP_000036734.1.19340 WP_000036734.1.1935 WP_000036734.1.19357 WP_000036734.1.19373 WP_000036734.1.1939 WP_000036734.1.19405 WP_000036734.1.19422 WP_000036734.1.19433 WP_000036734.1.19454 WP_000036734.1.19456 WP_000036734.1.19458 WP_000036734.1.19460 WP_000036734.1.19461 WP_000036734.1.19469 WP_000036734.1.19496 WP_000036734.1.19535 WP_000036734.1.19538 WP_000036734.1.1954 WP_000036734.1.1955 WP_000036734.1.19588 WP_000036734.1.19589 WP_000036734.1.19614 WP_000036734.1.19616 WP_000036734.1.19642 WP_000036734.1.19656 WP_000036734.1.19660 WP_000036734.1.19663 WP_000036734.1.1968 WP_000036734.1.19683 WP_000036734.1.19686 WP_000036734.1.19702 WP_000036734.1.19723 WP_000036734.1.19724 WP_000036734.1.19731 WP_000036734.1.19740 WP_000036734.1.19749 WP_000036734.1.19784 WP_000036734.1.19793 WP_000036734.1.19794 WP_000036734.1.19802 WP_000036734.1.19809 WP_000036734.1.19823 WP_000036734.1.19834 WP_000036734.1.19851 WP_000036734.1.19863 WP_000036734.1.19867 WP_000036734.1.19882 WP_000036734.1.19884 WP_000036734.1.1990 WP_000036734.1.1992 WP_000036734.1.19938 WP_000036734.1.19967 WP_000036734.1.19970 WP_000036734.1.19975 WP_000036734.1.1998 WP_000036734.1.19987 WP_000036734.1.19999 WP_000036734.1.20 WP_000036734.1.20023 WP_000036734.1.20034 WP_000036734.1.20081 WP_000036734.1.20086 WP_000036734.1.20089 WP_000036734.1.20091 WP_000036734.1.2010 WP_000036734.1.20119 WP_000036734.1.20153 WP_000036734.1.20212 WP_000036734.1.20218 WP_000036734.1.20254 WP_000036734.1.20255 WP_000036734.1.2026 WP_000036734.1.20261 WP_000036734.1.20266 WP_000036734.1.20271 WP_000036734.1.20296 WP_000036734.1.20330 WP_000036734.1.20339 WP_000036734.1.20349 WP_000036734.1.2036 WP_000036734.1.20362 WP_000036734.1.20364 WP_000036734.1.20376 WP_000036734.1.20391 WP_000036734.1.2041 WP_000036734.1.20415 WP_000036734.1.20418 WP_000036734.1.20419 WP_000036734.1.20425 WP_000036734.1.20437 WP_000036734.1.20438 WP_000036734.1.20443 WP_000036734.1.20446 WP_000036734.1.20465 WP_000036734.1.2047 WP_000036734.1.20488 WP_000036734.1.20492 WP_000036734.1.20503 WP_000036734.1.2053 WP_000036734.1.2054 WP_000036734.1.20553 WP_000036734.1.20564 WP_000036734.1.20573 WP_000036734.1.20614 WP_000036734.1.20626 WP_000036734.1.20631 WP_000036734.1.20635 WP_000036734.1.20646 WP_000036734.1.20695 WP_000036734.1.20700 WP_000036734.1.20718 WP_000036734.1.20721 WP_000036734.1.2073 WP_000036734.1.20740 WP_000036734.1.20760 WP_000036734.1.20787 WP_000036734.1.20789 WP_000036734.1.20795 WP_000036734.1.20810 WP_000036734.1.20828 WP_000036734.1.20839 WP_000036734.1.20862 WP_000036734.1.2087 WP_000036734.1.20883 WP_000036734.1.20886 WP_000036734.1.20900 WP_000036734.1.20908 WP_000036734.1.2091 WP_000036734.1.20947 WP_000036734.1.20953 WP_000036734.1.2101 WP_000036734.1.21010 WP_000036734.1.21049 WP_000036734.1.2106 WP_000036734.1.21062 WP_000036734.1.21075 WP_000036734.1.21079 WP_000036734.1.21086 WP_000036734.1.21089 WP_000036734.1.21103 WP_000036734.1.21136 WP_000036734.1.21144 WP_000036734.1.21146 WP_000036734.1.2116 WP_000036734.1.21162 WP_000036734.1.21165 WP_000036734.1.21181 WP_000036734.1.21184 WP_000036734.1.21185 WP_000036734.1.21194 WP_000036734.1.21202 WP_000036734.1.21241 WP_000036734.1.21245 WP_000036734.1.21246 WP_000036734.1.21260 WP_000036734.1.21269 WP_000036734.1.21286 WP_000036734.1.2130 WP_000036734.1.21309 WP_000036734.1.21326 WP_000036734.1.21332 WP_000036734.1.21351 WP_000036734.1.21362 WP_000036734.1.21366 WP_000036734.1.2139 WP_000036734.1.21399 WP_000036734.1.21400 WP_000036734.1.21404 WP_000036734.1.21423 WP_000036734.1.21443 WP_000036734.1.21453 WP_000036734.1.2146 WP_000036734.1.21473 WP_000036734.1.21492 WP_000036734.1.21497 WP_000036734.1.21499 WP_000036734.1.21534 WP_000036734.1.21548 WP_000036734.1.2155 WP_000036734.1.21603 WP_000036734.1.2166 WP_000036734.1.21674 WP_000036734.1.21681 WP_000036734.1.21692 WP_000036734.1.21715 WP_000036734.1.21728 WP_000036734.1.21730 WP_000036734.1.21750 WP_000036734.1.21751 WP_000036734.1.21757 WP_000036734.1.21792 WP_000036734.1.21825 WP_000036734.1.21845 WP_000036734.1.21877 WP_000036734.1.21886 WP_000036734.1.21909 WP_000036734.1.21910 WP_000036734.1.21940 WP_000036734.1.21946 WP_000036734.1.21950 WP_000036734.1.21966 WP_000036734.1.21981 WP_000036734.1.21991 WP_000036734.1.22019 WP_000036734.1.22024 WP_000036734.1.22026 WP_000036734.1.22030 WP_000036734.1.2205 WP_000036734.1.22051 WP_000036734.1.22062 WP_000036734.1.22064 WP_000036734.1.22067 WP_000036734.1.22069 WP_000036734.1.22096 WP_000036734.1.22117 WP_000036734.1.22118 WP_000036734.1.22126 WP_000036734.1.22136 WP_000036734.1.22158 WP_000036734.1.2216 WP_000036734.1.22162 WP_000036734.1.22169 WP_000036734.1.22205 WP_000036734.1.22208 WP_000036734.1.2221 WP_000036734.1.22235 WP_000036734.1.2224 WP_000036734.1.22240 WP_000036734.1.2227 WP_000036734.1.22270 WP_000036734.1.22296 WP_000036734.1.22303 WP_000036734.1.22315 WP_000036734.1.22323 WP_000036734.1.22337 WP_000036734.1.22346 WP_000036734.1.2235 WP_000036734.1.22373 WP_000036734.1.22379 WP_000036734.1.22388 WP_000036734.1.22427 WP_000036734.1.22449 WP_000036734.1.22451 WP_000036734.1.22453 WP_000036734.1.22454 WP_000036734.1.2246 WP_000036734.1.22460 WP_000036734.1.22476 WP_000036734.1.22485 WP_000036734.1.22514 WP_000036734.1.22537 WP_000036734.1.22565 WP_000036734.1.22566 WP_000036734.1.22575 WP_000036734.1.22582 WP_000036734.1.22595 WP_000036734.1.22604 WP_000036734.1.22605 WP_000036734.1.22614 WP_000036734.1.22620 WP_000036734.1.22623 WP_000036734.1.22645 WP_000036734.1.22652 WP_000036734.1.22676 WP_000036734.1.22683 WP_000036734.1.22692 WP_000036734.1.22758 WP_000036734.1.22760 WP_000036734.1.2283 WP_000036734.1.2284 WP_000036734.1.22845 WP_000036734.1.22855 WP_000036734.1.22857 WP_000036734.1.22864 WP_000036734.1.22870 WP_000036734.1.22880 WP_000036734.1.22895 WP_000036734.1.22902 WP_000036734.1.22926 WP_000036734.1.22943 WP_000036734.1.22947 WP_000036734.1.22966 WP_000036734.1.22967 WP_000036734.1.22979 WP_000036734.1.23010 WP_000036734.1.23040 WP_000036734.1.23041 WP_000036734.1.23053 WP_000036734.1.23058 WP_000036734.1.23080 WP_000036734.1.23102 WP_000036734.1.23114 WP_000036734.1.2314 WP_000036734.1.23148 WP_000036734.1.23155 WP_000036734.1.23169 WP_000036734.1.23172 WP_000036734.1.23175 WP_000036734.1.23192 WP_000036734.1.23201 WP_000036734.1.23218 WP_000036734.1.23219 WP_000036734.1.2324 WP_000036734.1.23246 WP_000036734.1.23258 WP_000036734.1.23259 WP_000036734.1.23274 WP_000036734.1.23279 WP_000036734.1.23309 WP_000036734.1.2331 WP_000036734.1.23311 WP_000036734.1.2332 WP_000036734.1.23329 WP_000036734.1.23340 WP_000036734.1.23341 WP_000036734.1.23343 WP_000036734.1.2336 WP_000036734.1.23365 WP_000036734.1.23379 WP_000036734.1.23409 WP_000036734.1.23412 WP_000036734.1.2342 WP_000036734.1.23426 WP_000036734.1.2343 WP_000036734.1.23442 WP_000036734.1.23444 WP_000036734.1.23460 WP_000036734.1.23466 WP_000036734.1.23472 WP_000036734.1.23482 WP_000036734.1.23485 WP_000036734.1.23492 WP_000036734.1.235 WP_000036734.1.23500 WP_000036734.1.23503 WP_000036734.1.23509 WP_000036734.1.23513 WP_000036734.1.23515 WP_000036734.1.23529 WP_000036734.1.23548 WP_000036734.1.23571 WP_000036734.1.2358 WP_000036734.1.23587 WP_000036734.1.23604 WP_000036734.1.23621 WP_000036734.1.23629 WP_000036734.1.23631 WP_000036734.1.23634 WP_000036734.1.23639 WP_000036734.1.2364 WP_000036734.1.23643 WP_000036734.1.23646 WP_000036734.1.23670 WP_000036734.1.23675 WP_000036734.1.23679 WP_000036734.1.23685 WP_000036734.1.237 WP_000036734.1.23707 WP_000036734.1.23720 WP_000036734.1.23728 WP_000036734.1.23736 WP_000036734.1.2375 WP_000036734.1.23755 WP_000036734.1.2376 WP_000036734.1.23783 WP_000036734.1.23786 WP_000036734.1.23787 WP_000036734.1.2380 WP_000036734.1.23801 WP_000036734.1.23819 WP_000036734.1.23932 WP_000036734.1.23959 WP_000036734.1.24017 WP_000036734.1.24028 WP_000036734.1.24061 WP_000036734.1.24082 WP_000036734.1.24083 WP_000036734.1.24117 WP_000036734.1.24125 WP_000036734.1.24138 WP_000036734.1.24145 WP_000036734.1.2415 WP_000036734.1.24153 WP_000036734.1.24158 WP_000036734.1.24163 WP_000036734.1.24206 WP_000036734.1.24214 WP_000036734.1.24250 WP_000036734.1.24259 WP_000036734.1.24291 WP_000036734.1.24297 WP_000036734.1.24303 WP_000036734.1.24308 WP_000036734.1.24322 WP_000036734.1.24325 WP_000036734.1.24355 WP_000036734.1.24361 WP_000036734.1.24375 WP_000036734.1.24376 WP_000036734.1.24392 WP_000036734.1.24394 WP_000036734.1.24400 WP_000036734.1.24408 WP_000036734.1.24409 WP_000036734.1.24412 WP_000036734.1.24419 WP_000036734.1.24420 WP_000036734.1.24433 WP_000036734.1.24444 WP_000036734.1.24450 WP_000036734.1.24476 WP_000036734.1.24494 WP_000036734.1.24521 WP_000036734.1.24555 WP_000036734.1.24567 WP_000036734.1.24578 WP_000036734.1.24619 WP_000036734.1.24643 WP_000036734.1.2467 WP_000036734.1.24673 WP_000036734.1.24686 WP_000036734.1.24688 WP_000036734.1.24689 WP_000036734.1.24696 WP_000036734.1.24716 WP_000036734.1.24723 WP_000036734.1.24727 WP_000036734.1.24737 WP_000036734.1.24779 WP_000036734.1.2481 WP_000036734.1.24832 WP_000036734.1.24837 WP_000036734.1.24839 WP_000036734.1.24873 WP_000036734.1.24901 WP_000036734.1.24944 WP_000036734.1.24964 WP_000036734.1.24995 WP_000036734.1.25008 WP_000036734.1.25015 WP_000036734.1.25017 WP_000036734.1.25032 WP_000036734.1.25036 WP_000036734.1.25041 WP_000036734.1.25053 WP_000036734.1.25064 WP_000036734.1.25072 WP_000036734.1.25119 WP_000036734.1.25130 WP_000036734.1.25140 WP_000036734.1.25159 WP_000036734.1.25175 WP_000036734.1.25185 WP_000036734.1.25196 WP_000036734.1.25205 WP_000036734.1.25206 WP_000036734.1.25210 WP_000036734.1.25217 WP_000036734.1.25219 WP_000036734.1.25229 WP_000036734.1.2525 WP_000036734.1.25297 WP_000036734.1.25304 WP_000036734.1.25354 WP_000036734.1.25374 WP_000036734.1.25397 WP_000036734.1.25405 WP_000036734.1.25426 WP_000036734.1.25454 WP_000036734.1.25475 WP_000036734.1.25490 WP_000036734.1.25493 WP_000036734.1.25498 WP_000036734.1.25508 WP_000036734.1.25512 WP_000036734.1.25514 WP_000036734.1.2554 WP_000036734.1.25546 WP_000036734.1.25564 WP_000036734.1.25596 WP_000036734.1.25603 WP_000036734.1.25607 WP_000036734.1.25618 WP_000036734.1.2562 WP_000036734.1.25666 WP_000036734.1.25668 WP_000036734.1.25690 WP_000036734.1.2570 WP_000036734.1.25700 WP_000036734.1.25703 WP_000036734.1.25708 WP_000036734.1.25722 WP_000036734.1.25740 WP_000036734.1.25780 WP_000036734.1.25793 WP_000036734.1.25807 WP_000036734.1.25809 WP_000036734.1.2581 WP_000036734.1.25814 WP_000036734.1.25821 WP_000036734.1.25825 WP_000036734.1.25833 WP_000036734.1.25835 WP_000036734.1.25846 WP_000036734.1.25882 WP_000036734.1.25911 WP_000036734.1.25928 WP_000036734.1.25932 WP_000036734.1.25944 WP_000036734.1.25951 WP_000036734.1.25962 WP_000036734.1.25963 WP_000036734.1.25988 WP_000036734.1.26001 WP_000036734.1.26027 WP_000036734.1.26030 WP_000036734.1.26034 WP_000036734.1.26075 WP_000036734.1.26083 WP_000036734.1.26093 WP_000036734.1.26107 WP_000036734.1.26122 WP_000036734.1.26123 WP_000036734.1.26129 WP_000036734.1.2615 WP_000036734.1.26194 WP_000036734.1.26199 WP_000036734.1.26213 WP_000036734.1.26217 WP_000036734.1.26224 WP_000036734.1.26230 WP_000036734.1.26232 WP_000036734.1.26269 WP_000036734.1.26272 WP_000036734.1.26282 WP_000036734.1.26286 WP_000036734.1.26288 WP_000036734.1.26311 WP_000036734.1.26319 WP_000036734.1.2634 WP_000036734.1.26363 WP_000036734.1.26384 WP_000036734.1.26394 WP_000036734.1.26414 WP_000036734.1.26426 WP_000036734.1.26429 WP_000036734.1.26440 WP_000036734.1.26441 WP_000036734.1.26491 WP_000036734.1.26493 WP_000036734.1.26512 WP_000036734.1.2654 WP_000036734.1.26551 WP_000036734.1.26554 WP_000036734.1.26563 WP_000036734.1.26567 WP_000036734.1.26576 WP_000036734.1.26582 WP_000036734.1.2660 WP_000036734.1.26636 WP_000036734.1.26646 WP_000036734.1.2667 WP_000036734.1.26687 WP_000036734.1.26689 WP_000036734.1.26709 WP_000036734.1.2672 WP_000036734.1.26741 WP_000036734.1.26750 WP_000036734.1.26758 WP_000036734.1.26787 WP_000036734.1.2679 WP_000036734.1.26794 WP_000036734.1.26833 WP_000036734.1.26856 WP_000036734.1.26882 WP_000036734.1.26883 WP_000036734.1.26892 WP_000036734.1.26908 WP_000036734.1.26919 WP_000036734.1.2692 WP_000036734.1.26924 WP_000036734.1.26928 WP_000036734.1.26936 WP_000036734.1.26980 WP_000036734.1.270 WP_000036734.1.27008 WP_000036734.1.27010 WP_000036734.1.27027 WP_000036734.1.27051 WP_000036734.1.27055 WP_000036734.1.27070 WP_000036734.1.27072 WP_000036734.1.27077 WP_000036734.1.27084 WP_000036734.1.27086 WP_000036734.1.27087 WP_000036734.1.27111 WP_000036734.1.27115 WP_000036734.1.27122 WP_000036734.1.27123 WP_000036734.1.2713 WP_000036734.1.27142 WP_000036734.1.27169 WP_000036734.1.2717 WP_000036734.1.27173 WP_000036734.1.272 WP_000036734.1.27206 WP_000036734.1.27223 WP_000036734.1.27228 WP_000036734.1.2723 WP_000036734.1.27255 WP_000036734.1.27272 WP_000036734.1.27279 WP_000036734.1.27282 WP_000036734.1.27285 WP_000036734.1.27309 WP_000036734.1.27314 WP_000036734.1.27329 WP_000036734.1.27342 WP_000036734.1.27361 WP_000036734.1.27383 WP_000036734.1.27419 WP_000036734.1.27423 WP_000036734.1.27452 WP_000036734.1.27513 WP_000036734.1.27522 WP_000036734.1.27523 WP_000036734.1.27535 WP_000036734.1.27544 WP_000036734.1.27547 WP_000036734.1.27556 WP_000036734.1.27561 WP_000036734.1.27565 WP_000036734.1.27595 WP_000036734.1.27598 WP_000036734.1.27616 WP_000036734.1.2763 WP_000036734.1.27632 WP_000036734.1.27638 WP_000036734.1.27655 WP_000036734.1.27658 WP_000036734.1.27665 WP_000036734.1.27679 WP_000036734.1.27706 WP_000036734.1.27707 WP_000036734.1.27713 WP_000036734.1.27755 WP_000036734.1.27761 WP_000036734.1.2777 WP_000036734.1.27775 WP_000036734.1.27776 WP_000036734.1.27785 WP_000036734.1.27798 WP_000036734.1.27800 WP_000036734.1.27815 WP_000036734.1.27833 WP_000036734.1.27857 WP_000036734.1.27883 WP_000036734.1.27892 WP_000036734.1.27900 WP_000036734.1.27928 WP_000036734.1.27945 WP_000036734.1.27969 WP_000036734.1.27995 WP_000036734.1.27997 WP_000036734.1.28002 WP_000036734.1.28004 WP_000036734.1.28032 WP_000036734.1.28037 WP_000036734.1.28056 WP_000036734.1.2806 WP_000036734.1.28073 WP_000036734.1.2809 WP_000036734.1.28094 WP_000036734.1.28116 WP_000036734.1.28126 WP_000036734.1.28139 WP_000036734.1.28155 WP_000036734.1.28170 WP_000036734.1.28174 WP_000036734.1.28198 WP_000036734.1.28200 WP_000036734.1.2822 WP_000036734.1.28225 WP_000036734.1.28229 WP_000036734.1.28232 WP_000036734.1.28233 WP_000036734.1.28235 WP_000036734.1.2825 WP_000036734.1.28267 WP_000036734.1.2829 WP_000036734.1.28301 WP_000036734.1.28302 WP_000036734.1.28303 WP_000036734.1.2835 WP_000036734.1.28370 WP_000036734.1.28384 WP_000036734.1.28386 WP_000036734.1.28393 WP_000036734.1.28395 WP_000036734.1.284 WP_000036734.1.2845 WP_000036734.1.28462 WP_000036734.1.28479 WP_000036734.1.28504 WP_000036734.1.28512 WP_000036734.1.28514 WP_000036734.1.2853 WP_000036734.1.28538 WP_000036734.1.28570 WP_000036734.1.28575 WP_000036734.1.28612 WP_000036734.1.28620 WP_000036734.1.28625 WP_000036734.1.28627 WP_000036734.1.28655 WP_000036734.1.28665 WP_000036734.1.28673 WP_000036734.1.28692 WP_000036734.1.28694 WP_000036734.1.287 WP_000036734.1.2873 WP_000036734.1.28733 WP_000036734.1.28773 WP_000036734.1.28775 WP_000036734.1.28776 WP_000036734.1.2879 WP_000036734.1.28811 WP_000036734.1.28830 WP_000036734.1.2890 WP_000036734.1.28902 WP_000036734.1.28917 WP_000036734.1.28921 WP_000036734.1.28938 WP_000036734.1.28946 WP_000036734.1.28948 WP_000036734.1.28962 WP_000036734.1.28963 WP_000036734.1.28977 WP_000036734.1.29006 WP_000036734.1.29010 WP_000036734.1.29023 WP_000036734.1.29042 WP_000036734.1.2905 WP_000036734.1.2907 WP_000036734.1.29081 WP_000036734.1.29089 WP_000036734.1.29099 WP_000036734.1.2910 WP_000036734.1.29113 WP_000036734.1.29130 WP_000036734.1.2915 WP_000036734.1.29153 WP_000036734.1.29168 WP_000036734.1.29174 WP_000036734.1.29190 WP_000036734.1.29203 WP_000036734.1.29218 WP_000036734.1.29237 WP_000036734.1.2924 WP_000036734.1.29248 WP_000036734.1.29255 WP_000036734.1.29265 WP_000036734.1.29288 WP_000036734.1.2932 WP_000036734.1.29349 WP_000036734.1.29379 WP_000036734.1.29389 WP_000036734.1.29422 WP_000036734.1.29436 WP_000036734.1.29439 WP_000036734.1.29454 WP_000036734.1.2946 WP_000036734.1.29462 WP_000036734.1.29509 WP_000036734.1.29530 WP_000036734.1.29563 WP_000036734.1.29576 WP_000036734.1.29588 WP_000036734.1.29593 WP_000036734.1.29601 WP_000036734.1.29606 WP_000036734.1.29615 WP_000036734.1.29619 WP_000036734.1.29682 WP_000036734.1.29704 WP_000036734.1.29711 WP_000036734.1.29727 WP_000036734.1.29732 WP_000036734.1.2974 WP_000036734.1.29743 WP_000036734.1.29768 WP_000036734.1.29774 WP_000036734.1.29782 WP_000036734.1.29827 WP_000036734.1.29833 WP_000036734.1.2984 WP_000036734.1.29845 WP_000036734.1.29851 WP_000036734.1.29865 WP_000036734.1.29886 WP_000036734.1.29898 WP_000036734.1.29919 WP_000036734.1.29923 WP_000036734.1.29924 WP_000036734.1.2994 WP_000036734.1.29964 WP_000036734.1.29969 WP_000036734.1.29983 WP_000036734.1.29990 WP_000036734.1.30006 WP_000036734.1.30009 WP_000036734.1.30013 WP_000036734.1.30018 WP_000036734.1.3002 WP_000036734.1.30022 WP_000036734.1.30027 WP_000036734.1.30034 WP_000036734.1.30049 WP_000036734.1.3005 WP_000036734.1.30058 WP_000036734.1.30086 WP_000036734.1.30093 WP_000036734.1.30165 WP_000036734.1.3017 WP_000036734.1.30170 WP_000036734.1.30172 WP_000036734.1.30179 WP_000036734.1.30180 WP_000036734.1.30185 WP_000036734.1.30195 WP_000036734.1.30202 WP_000036734.1.30210 WP_000036734.1.30213 WP_000036734.1.30225 WP_000036734.1.30238 WP_000036734.1.30246 WP_000036734.1.30278 WP_000036734.1.30331 WP_000036734.1.30354 WP_000036734.1.30356 WP_000036734.1.30357 WP_000036734.1.30362 WP_000036734.1.30386 WP_000036734.1.30389 WP_000036734.1.3042 WP_000036734.1.30421 WP_000036734.1.30425 WP_000036734.1.30437 WP_000036734.1.30440 WP_000036734.1.30448 WP_000036734.1.30469 WP_000036734.1.30489 WP_000036734.1.30492 WP_000036734.1.30505 WP_000036734.1.30507 WP_000036734.1.30517 WP_000036734.1.30535 WP_000036734.1.30542 WP_000036734.1.30544 WP_000036734.1.30547 WP_000036734.1.30548 WP_000036734.1.30555 WP_000036734.1.30556 WP_000036734.1.30572 WP_000036734.1.30573 WP_000036734.1.30585 WP_000036734.1.30589 WP_000036734.1.30602 WP_000036734.1.30618 WP_000036734.1.30619 WP_000036734.1.30627 WP_000036734.1.30635 WP_000036734.1.3066 WP_000036734.1.30664 WP_000036734.1.3068 WP_000036734.1.30688 WP_000036734.1.30696 WP_000036734.1.30752 WP_000036734.1.3076 WP_000036734.1.30794 WP_000036734.1.3080 WP_000036734.1.30802 WP_000036734.1.30803 WP_000036734.1.30806 WP_000036734.1.30819 WP_000036734.1.30823 WP_000036734.1.30833 WP_000036734.1.30835 WP_000036734.1.3089 WP_000036734.1.30909 WP_000036734.1.30934 WP_000036734.1.3095 WP_000036734.1.30951 WP_000036734.1.30967 WP_000036734.1.30968 WP_000036734.1.30972 WP_000036734.1.31 WP_000036734.1.31001 WP_000036734.1.31011 WP_000036734.1.31042 WP_000036734.1.31046 WP_000036734.1.31066 WP_000036734.1.31069 WP_000036734.1.31078 WP_000036734.1.31086 WP_000036734.1.31092 WP_000036734.1.31107 WP_000036734.1.31111 WP_000036734.1.31122 WP_000036734.1.3113 WP_000036734.1.31139 WP_000036734.1.3114 WP_000036734.1.31145 WP_000036734.1.31155 WP_000036734.1.31156 WP_000036734.1.31167 WP_000036734.1.31171 WP_000036734.1.31182 WP_000036734.1.31185 WP_000036734.1.3119 WP_000036734.1.31190 WP_000036734.1.31195 WP_000036734.1.31196 WP_000036734.1.31198 WP_000036734.1.31205 WP_000036734.1.3121 WP_000036734.1.31210 WP_000036734.1.31214 WP_000036734.1.31219 WP_000036734.1.31222 WP_000036734.1.31223 WP_000036734.1.3124 WP_000036734.1.31240 WP_000036734.1.31251 WP_000036734.1.31262 WP_000036734.1.3127 WP_000036734.1.31272 WP_000036734.1.31281 WP_000036734.1.31303 WP_000036734.1.3131 WP_000036734.1.31335 WP_000036734.1.31352 WP_000036734.1.31362 WP_000036734.1.31389 WP_000036734.1.31413 WP_000036734.1.31435 WP_000036734.1.31446 WP_000036734.1.31451 WP_000036734.1.31476 WP_000036734.1.31504 WP_000036734.1.31515 WP_000036734.1.31533 WP_000036734.1.31546 WP_000036734.1.31578 WP_000036734.1.31585 WP_000036734.1.31590 WP_000036734.1.31658 WP_000036734.1.31665 WP_000036734.1.3167 WP_000036734.1.3170 WP_000036734.1.31720 WP_000036734.1.31762 WP_000036734.1.31782 WP_000036734.1.31799 WP_000036734.1.31836 WP_000036734.1.31845 WP_000036734.1.3185 WP_000036734.1.31854 WP_000036734.1.31895 WP_000036734.1.31901 WP_000036734.1.31927 WP_000036734.1.31940 WP_000036734.1.31951 WP_000036734.1.31952 WP_000036734.1.31967 WP_000036734.1.31972 WP_000036734.1.32006 WP_000036734.1.32038 WP_000036734.1.32041 WP_000036734.1.32042 WP_000036734.1.32054 WP_000036734.1.32056 WP_000036734.1.3207 WP_000036734.1.3208 WP_000036734.1.32109 WP_000036734.1.32116 WP_000036734.1.32170 WP_000036734.1.32189 WP_000036734.1.32192 WP_000036734.1.32202 WP_000036734.1.32204 WP_000036734.1.32206 WP_000036734.1.32252 WP_000036734.1.32255 WP_000036734.1.32260 WP_000036734.1.32263 WP_000036734.1.32274 WP_000036734.1.32275 WP_000036734.1.32277 WP_000036734.1.32293 WP_000036734.1.32299 WP_000036734.1.32309 WP_000036734.1.32357 WP_000036734.1.32368 WP_000036734.1.32408 WP_000036734.1.32422 WP_000036734.1.32423 WP_000036734.1.32424 WP_000036734.1.32425 WP_000036734.1.32434 WP_000036734.1.32438 WP_000036734.1.32458 WP_000036734.1.32459 WP_000036734.1.32460 WP_000036734.1.32491 WP_000036734.1.32493 WP_000036734.1.32515 WP_000036734.1.32519 WP_000036734.1.32527 WP_000036734.1.32529 WP_000036734.1.32545 WP_000036734.1.32563 WP_000036734.1.32578 WP_000036734.1.32617 WP_000036734.1.32624 WP_000036734.1.32629 WP_000036734.1.32643 WP_000036734.1.32660 WP_000036734.1.32668 WP_000036734.1.3270 WP_000036734.1.32702 WP_000036734.1.32714 WP_000036734.1.32725 WP_000036734.1.32740 WP_000036734.1.32747 WP_000036734.1.32750 WP_000036734.1.3278 WP_000036734.1.32786 WP_000036734.1.32804 WP_000036734.1.32832 WP_000036734.1.32838 WP_000036734.1.32848 WP_000036734.1.32860 WP_000036734.1.32868 WP_000036734.1.32881 WP_000036734.1.32899 WP_000036734.1.329 WP_000036734.1.3290 WP_000036734.1.32900 WP_000036734.1.32902 WP_000036734.1.32907 WP_000036734.1.32930 WP_000036734.1.32940 WP_000036734.1.32941 WP_000036734.1.3296 WP_000036734.1.32961 WP_000036734.1.32966 WP_000036734.1.32977 WP_000036734.1.32985 WP_000036734.1.33010 WP_000036734.1.33030 WP_000036734.1.33037 WP_000036734.1.3304 WP_000036734.1.3305 WP_000036734.1.33050 WP_000036734.1.33051 WP_000036734.1.33065 WP_000036734.1.33068 WP_000036734.1.33078 WP_000036734.1.3310 WP_000036734.1.33106 WP_000036734.1.33114 WP_000036734.1.33122 WP_000036734.1.33127 WP_000036734.1.33134 WP_000036734.1.33143 WP_000036734.1.33144 WP_000036734.1.3315 WP_000036734.1.33160 WP_000036734.1.33208 WP_000036734.1.33214 WP_000036734.1.33247 WP_000036734.1.33248 WP_000036734.1.33253 WP_000036734.1.33261 WP_000036734.1.33270 WP_000036734.1.33280 WP_000036734.1.33283 WP_000036734.1.333 WP_000036734.1.33313 WP_000036734.1.33339 WP_000036734.1.33343 WP_000036734.1.33382 WP_000036734.1.33392 WP_000036734.1.33409 WP_000036734.1.33420 WP_000036734.1.33486 WP_000036734.1.33490 WP_000036734.1.33492 WP_000036734.1.33499 WP_000036734.1.335 WP_000036734.1.33501 WP_000036734.1.33504 WP_000036734.1.33529 WP_000036734.1.33553 WP_000036734.1.3356 WP_000036734.1.33580 WP_000036734.1.33586 WP_000036734.1.33592 WP_000036734.1.33609 WP_000036734.1.33629 WP_000036734.1.3364 WP_000036734.1.33689 WP_000036734.1.33693 WP_000036734.1.3370 WP_000036734.1.33730 WP_000036734.1.33741 WP_000036734.1.33786 WP_000036734.1.33817 WP_000036734.1.33840 WP_000036734.1.33870 WP_000036734.1.33894 WP_000036734.1.3392 WP_000036734.1.33926 WP_000036734.1.3394 WP_000036734.1.3395 WP_000036734.1.33957 WP_000036734.1.3396 WP_000036734.1.33969 WP_000036734.1.33986 WP_000036734.1.34 WP_000036734.1.34001 WP_000036734.1.34022 WP_000036734.1.34043 WP_000036734.1.34059 WP_000036734.1.34075 WP_000036734.1.34081 WP_000036734.1.34084 WP_000036734.1.34091 WP_000036734.1.34107 WP_000036734.1.34118 WP_000036734.1.34126 WP_000036734.1.34179 WP_000036734.1.34184 WP_000036734.1.34185 WP_000036734.1.34211 WP_000036734.1.34214 WP_000036734.1.34234 WP_000036734.1.34257 WP_000036734.1.34259 WP_000036734.1.34279 WP_000036734.1.34284 WP_000036734.1.34292 WP_000036734.1.34304 WP_000036734.1.34319 WP_000036734.1.34330 WP_000036734.1.34364 WP_000036734.1.34376 WP_000036734.1.3438 WP_000036734.1.34382 WP_000036734.1.34417 WP_000036734.1.34424 WP_000036734.1.34431 WP_000036734.1.3445 WP_000036734.1.34453 WP_000036734.1.34454 WP_000036734.1.34458 WP_000036734.1.34484 WP_000036734.1.34496 WP_000036734.1.34517 WP_000036734.1.34530 WP_000036734.1.34539 WP_000036734.1.34610 WP_000036734.1.34614 WP_000036734.1.34647 WP_000036734.1.34659 WP_000036734.1.34665 WP_000036734.1.34667 WP_000036734.1.34694 WP_000036734.1.34703 WP_000036734.1.34704 WP_000036734.1.34707 WP_000036734.1.34711 WP_000036734.1.34745 WP_000036734.1.34751 WP_000036734.1.34801 WP_000036734.1.34808 WP_000036734.1.34817 WP_000036734.1.34820 WP_000036734.1.34824 WP_000036734.1.34834 WP_000036734.1.34854 WP_000036734.1.34856 WP_000036734.1.34881 WP_000036734.1.3489 WP_000036734.1.34907 WP_000036734.1.34932 WP_000036734.1.34962 WP_000036734.1.34972 WP_000036734.1.34975 WP_000036734.1.34977 WP_000036734.1.35001 WP_000036734.1.35035 WP_000036734.1.35040 WP_000036734.1.35045 WP_000036734.1.35074 WP_000036734.1.35075 WP_000036734.1.35125 WP_000036734.1.35129 WP_000036734.1.35175 WP_000036734.1.35184 WP_000036734.1.35193 WP_000036734.1.35219 WP_000036734.1.35240 WP_000036734.1.35274 WP_000036734.1.35294 WP_000036734.1.35298 WP_000036734.1.35321 WP_000036734.1.35331 WP_000036734.1.35371 WP_000036734.1.35404 WP_000036734.1.35408 WP_000036734.1.3541 WP_000036734.1.35425 WP_000036734.1.35429 WP_000036734.1.35446 WP_000036734.1.35460 WP_000036734.1.35463 WP_000036734.1.35494 WP_000036734.1.35503 WP_000036734.1.35507 WP_000036734.1.35509 WP_000036734.1.35532 WP_000036734.1.3556 WP_000036734.1.35560 WP_000036734.1.35563 WP_000036734.1.3557 WP_000036734.1.35570 WP_000036734.1.35575 WP_000036734.1.35590 WP_000036734.1.35594 WP_000036734.1.35624 WP_000036734.1.35628 WP_000036734.1.35648 WP_000036734.1.3566 WP_000036734.1.3570 WP_000036734.1.35712 WP_000036734.1.35713 WP_000036734.1.35736 WP_000036734.1.35777 WP_000036734.1.35791 WP_000036734.1.35795 WP_000036734.1.35835 WP_000036734.1.35868 WP_000036734.1.35870 WP_000036734.1.35887 WP_000036734.1.35892 WP_000036734.1.35916 WP_000036734.1.35936 WP_000036734.1.35938 WP_000036734.1.35940 WP_000036734.1.35961 WP_000036734.1.35966 WP_000036734.1.36000 WP_000036734.1.36003 WP_000036734.1.3601 WP_000036734.1.36011 WP_000036734.1.36017 WP_000036734.1.36034 WP_000036734.1.36036 WP_000036734.1.36037 WP_000036734.1.36057 WP_000036734.1.36063 WP_000036734.1.36069 WP_000036734.1.3610 WP_000036734.1.36157 WP_000036734.1.36172 WP_000036734.1.36229 WP_000036734.1.36232 WP_000036734.1.36236 WP_000036734.1.36286 WP_000036734.1.36291 WP_000036734.1.36298 WP_000036734.1.36308 WP_000036734.1.36323 WP_000036734.1.36343 WP_000036734.1.36409 WP_000036734.1.36425 WP_000036734.1.36445 WP_000036734.1.36460 WP_000036734.1.3649 WP_000036734.1.36495 WP_000036734.1.36512 WP_000036734.1.36526 WP_000036734.1.36542 WP_000036734.1.36547 WP_000036734.1.36564 WP_000036734.1.36567 WP_000036734.1.36579 WP_000036734.1.36584 WP_000036734.1.36586 WP_000036734.1.36592 WP_000036734.1.36609 WP_000036734.1.36617 WP_000036734.1.36618 WP_000036734.1.36643 WP_000036734.1.36652 WP_000036734.1.36663 WP_000036734.1.36685 WP_000036734.1.36690 WP_000036734.1.3670 WP_000036734.1.36701 WP_000036734.1.36705 WP_000036734.1.36721 WP_000036734.1.36725 WP_000036734.1.36751 WP_000036734.1.36764 WP_000036734.1.36765 WP_000036734.1.36779 WP_000036734.1.36792 WP_000036734.1.36798 WP_000036734.1.36802 WP_000036734.1.36821 WP_000036734.1.36839 WP_000036734.1.36853 WP_000036734.1.36875 WP_000036734.1.3688 WP_000036734.1.36885 WP_000036734.1.36889 WP_000036734.1.36899 WP_000036734.1.36918 WP_000036734.1.36931 WP_000036734.1.36948 WP_000036734.1.36949 WP_000036734.1.36950 WP_000036734.1.36978 WP_000036734.1.37013 WP_000036734.1.37014 WP_000036734.1.37021 WP_000036734.1.37028 WP_000036734.1.37029 WP_000036734.1.37063 WP_000036734.1.37073 WP_000036734.1.37100 WP_000036734.1.37111 WP_000036734.1.37112 WP_000036734.1.37114 WP_000036734.1.37119 WP_000036734.1.37133 WP_000036734.1.37147 WP_000036734.1.37158 WP_000036734.1.37176 WP_000036734.1.37190 WP_000036734.1.37191 WP_000036734.1.37199 WP_000036734.1.37200 WP_000036734.1.37256 WP_000036734.1.37258 WP_000036734.1.37267 WP_000036734.1.3728 WP_000036734.1.37293 WP_000036734.1.37297 WP_000036734.1.37303 WP_000036734.1.37320 WP_000036734.1.3734 WP_000036734.1.37351 WP_000036734.1.37363 WP_000036734.1.37370 WP_000036734.1.37376 WP_000036734.1.37405 WP_000036734.1.3741 WP_000036734.1.3744 WP_000036734.1.37478 WP_000036734.1.3748 WP_000036734.1.37498 WP_000036734.1.37504 WP_000036734.1.3751 WP_000036734.1.37513 WP_000036734.1.37521 WP_000036734.1.37558 WP_000036734.1.3756 WP_000036734.1.37584 WP_000036734.1.37590 WP_000036734.1.37593 WP_000036734.1.37600 WP_000036734.1.37610 WP_000036734.1.37613 WP_000036734.1.37618 WP_000036734.1.37659 WP_000036734.1.37662 WP_000036734.1.37666 WP_000036734.1.37675 WP_000036734.1.37687 WP_000036734.1.37691 WP_000036734.1.3771 WP_000036734.1.37719 WP_000036734.1.37761 WP_000036734.1.37775 WP_000036734.1.37777 WP_000036734.1.3778 WP_000036734.1.378 WP_000036734.1.37808 WP_000036734.1.37848 WP_000036734.1.37864 WP_000036734.1.379 WP_000036734.1.3790 WP_000036734.1.37911 WP_000036734.1.37941 WP_000036734.1.37965 WP_000036734.1.37968 WP_000036734.1.37978 WP_000036734.1.37985 WP_000036734.1.38001 WP_000036734.1.38026 WP_000036734.1.38037 WP_000036734.1.38047 WP_000036734.1.38055 WP_000036734.1.38061 WP_000036734.1.38064 WP_000036734.1.38108 WP_000036734.1.38113 WP_000036734.1.38125 WP_000036734.1.38145 WP_000036734.1.3816 WP_000036734.1.38199 WP_000036734.1.38207 WP_000036734.1.38261 WP_000036734.1.38266 WP_000036734.1.38273 WP_000036734.1.3828 WP_000036734.1.383 WP_000036734.1.38310 WP_000036734.1.38322 WP_000036734.1.3834 WP_000036734.1.38341 WP_000036734.1.38344 WP_000036734.1.38349 WP_000036734.1.38351 WP_000036734.1.3838 WP_000036734.1.38381 WP_000036734.1.38393 WP_000036734.1.38404 WP_000036734.1.38408 WP_000036734.1.38440 WP_000036734.1.38452 WP_000036734.1.3848 WP_000036734.1.38486 WP_000036734.1.38512 WP_000036734.1.38515 WP_000036734.1.38569 WP_000036734.1.38595 WP_000036734.1.3860 WP_000036734.1.38609 WP_000036734.1.38613 WP_000036734.1.38620 WP_000036734.1.38622 WP_000036734.1.38642 WP_000036734.1.38673 WP_000036734.1.3869 WP_000036734.1.38693 WP_000036734.1.38734 WP_000036734.1.38740 WP_000036734.1.38773 WP_000036734.1.38781 WP_000036734.1.38797 WP_000036734.1.38830 WP_000036734.1.38857 WP_000036734.1.38877 WP_000036734.1.38881 WP_000036734.1.38882 WP_000036734.1.38886 WP_000036734.1.38895 WP_000036734.1.3891 WP_000036734.1.38913 WP_000036734.1.38942 WP_000036734.1.38983 WP_000036734.1.38995 WP_000036734.1.38996 WP_000036734.1.39003 WP_000036734.1.39038 WP_000036734.1.39048 WP_000036734.1.39055 WP_000036734.1.39056 WP_000036734.1.39059 WP_000036734.1.39065 WP_000036734.1.3907 WP_000036734.1.39075 WP_000036734.1.39105 WP_000036734.1.39112 WP_000036734.1.39113 WP_000036734.1.39128 WP_000036734.1.39136 WP_000036734.1.3914 WP_000036734.1.39140 WP_000036734.1.39146 WP_000036734.1.39147 WP_000036734.1.39161 WP_000036734.1.39183 WP_000036734.1.39197 WP_000036734.1.39210 WP_000036734.1.39229 WP_000036734.1.39235 WP_000036734.1.39265 WP_000036734.1.39275 WP_000036734.1.3931 WP_000036734.1.39312 WP_000036734.1.39385 WP_000036734.1.39395 WP_000036734.1.39405 WP_000036734.1.39420 WP_000036734.1.39435 WP_000036734.1.39449 WP_000036734.1.39466 WP_000036734.1.39471 WP_000036734.1.39484 WP_000036734.1.39497 WP_000036734.1.39502 WP_000036734.1.39503 WP_000036734.1.39512 WP_000036734.1.39530 WP_000036734.1.39553 WP_000036734.1.39556 WP_000036734.1.39576 WP_000036734.1.39584 WP_000036734.1.39609 WP_000036734.1.39619 WP_000036734.1.39620 WP_000036734.1.39624 WP_000036734.1.39629 WP_000036734.1.39632 WP_000036734.1.39659 WP_000036734.1.39667 WP_000036734.1.39722 WP_000036734.1.39723 WP_000036734.1.39724 WP_000036734.1.39763 WP_000036734.1.39775 WP_000036734.1.39808 WP_000036734.1.39862 WP_000036734.1.39879 WP_000036734.1.39890 WP_000036734.1.39921 WP_000036734.1.39923 WP_000036734.1.39941 WP_000036734.1.39945 WP_000036734.1.39947 WP_000036734.1.39953 WP_000036734.1.40008 WP_000036734.1.40017 WP_000036734.1.40025 WP_000036734.1.40031 WP_000036734.1.40072 WP_000036734.1.40073 WP_000036734.1.40081 WP_000036734.1.40095 WP_000036734.1.40097 WP_000036734.1.401 WP_000036734.1.4011 WP_000036734.1.40111 WP_000036734.1.40155 WP_000036734.1.40160 WP_000036734.1.40167 WP_000036734.1.40170 WP_000036734.1.40171 WP_000036734.1.40205 WP_000036734.1.40208 WP_000036734.1.40224 WP_000036734.1.40229 WP_000036734.1.40240 WP_000036734.1.40254 WP_000036734.1.40257 WP_000036734.1.40258 WP_000036734.1.40259 WP_000036734.1.40279 WP_000036734.1.40292 WP_000036734.1.40305 WP_000036734.1.40307 WP_000036734.1.40311 WP_000036734.1.40341 WP_000036734.1.40361 WP_000036734.1.4037 WP_000036734.1.40374 WP_000036734.1.40380 WP_000036734.1.40395 WP_000036734.1.40414 WP_000036734.1.4042 WP_000036734.1.40465 WP_000036734.1.40467 WP_000036734.1.40492 WP_000036734.1.40493 WP_000036734.1.40496 WP_000036734.1.40508 WP_000036734.1.40517 WP_000036734.1.40533 WP_000036734.1.40577 WP_000036734.1.40583 WP_000036734.1.40605 WP_000036734.1.40622 WP_000036734.1.40648 WP_000036734.1.40688 WP_000036734.1.40693 WP_000036734.1.40695 WP_000036734.1.40698 WP_000036734.1.40710 WP_000036734.1.40722 WP_000036734.1.40745 WP_000036734.1.40750 WP_000036734.1.40763 WP_000036734.1.40771 WP_000036734.1.40788 WP_000036734.1.40849 WP_000036734.1.40854 WP_000036734.1.4087 WP_000036734.1.40877 WP_000036734.1.4088 WP_000036734.1.4089 WP_000036734.1.40910 WP_000036734.1.40924 WP_000036734.1.40930 WP_000036734.1.40932 WP_000036734.1.40935 WP_000036734.1.40946 WP_000036734.1.40973 WP_000036734.1.40979 WP_000036734.1.40996 WP_000036734.1.41004 WP_000036734.1.41017 WP_000036734.1.41018 WP_000036734.1.41048 WP_000036734.1.41050 WP_000036734.1.4106 WP_000036734.1.41070 WP_000036734.1.41074 WP_000036734.1.41075 WP_000036734.1.41086 WP_000036734.1.4109 WP_000036734.1.41091 WP_000036734.1.41097 WP_000036734.1.41116 WP_000036734.1.41128 WP_000036734.1.41132 WP_000036734.1.4114 WP_000036734.1.41176 WP_000036734.1.41192 WP_000036734.1.41225 WP_000036734.1.41226 WP_000036734.1.41251 WP_000036734.1.41258 WP_000036734.1.41265 WP_000036734.1.41277 WP_000036734.1.41279 WP_000036734.1.41299 WP_000036734.1.41305 WP_000036734.1.41308 WP_000036734.1.41310 WP_000036734.1.41321 WP_000036734.1.41333 WP_000036734.1.41335 WP_000036734.1.41345 WP_000036734.1.4136 WP_000036734.1.41375 WP_000036734.1.41415 WP_000036734.1.41427 WP_000036734.1.41438 WP_000036734.1.41440 WP_000036734.1.41459 WP_000036734.1.41468 WP_000036734.1.41497 WP_000036734.1.41498 WP_000036734.1.41516 WP_000036734.1.41519 WP_000036734.1.41524 WP_000036734.1.41528 WP_000036734.1.41554 WP_000036734.1.41572 WP_000036734.1.41591 WP_000036734.1.41593 WP_000036734.1.41610 WP_000036734.1.41628 WP_000036734.1.41631 WP_000036734.1.41658 WP_000036734.1.41659 WP_000036734.1.41662 WP_000036734.1.41688 WP_000036734.1.41690 WP_000036734.1.41708 WP_000036734.1.41716 WP_000036734.1.41724 WP_000036734.1.41735 WP_000036734.1.41746 WP_000036734.1.41761 WP_000036734.1.4178 WP_000036734.1.41789 WP_000036734.1.41799 WP_000036734.1.41802 WP_000036734.1.41824 WP_000036734.1.41825 WP_000036734.1.41836 WP_000036734.1.4184 WP_000036734.1.41859 WP_000036734.1.41862 WP_000036734.1.41877 WP_000036734.1.41882 WP_000036734.1.41894 WP_000036734.1.41897 WP_000036734.1.41904 WP_000036734.1.41911 WP_000036734.1.41919 WP_000036734.1.41929 WP_000036734.1.41931 WP_000036734.1.41938 WP_000036734.1.4194 WP_000036734.1.41949 WP_000036734.1.41978 WP_000036734.1.41979 WP_000036734.1.41985 WP_000036734.1.41994 WP_000036734.1.41998 WP_000036734.1.42009 WP_000036734.1.42069 WP_000036734.1.42081 WP_000036734.1.42090 WP_000036734.1.42098 WP_000036734.1.42104 WP_000036734.1.42109 WP_000036734.1.42111 WP_000036734.1.42136 WP_000036734.1.42156 WP_000036734.1.42187 WP_000036734.1.422 WP_000036734.1.42200 WP_000036734.1.42219 WP_000036734.1.4222 WP_000036734.1.42238 WP_000036734.1.42243 WP_000036734.1.42244 WP_000036734.1.42248 WP_000036734.1.42257 WP_000036734.1.42261 WP_000036734.1.42262 WP_000036734.1.42263 WP_000036734.1.42276 WP_000036734.1.4229 WP_000036734.1.42320 WP_000036734.1.42322 WP_000036734.1.42328 WP_000036734.1.42342 WP_000036734.1.42349 WP_000036734.1.42356 WP_000036734.1.42364 WP_000036734.1.42371 WP_000036734.1.42372 WP_000036734.1.42379 WP_000036734.1.4239 WP_000036734.1.42391 WP_000036734.1.42392 WP_000036734.1.42394 WP_000036734.1.42399 WP_000036734.1.42404 WP_000036734.1.42422 WP_000036734.1.42433 WP_000036734.1.42444 WP_000036734.1.42453 WP_000036734.1.42489 WP_000036734.1.42491 WP_000036734.1.42539 WP_000036734.1.4254 WP_000036734.1.4257 WP_000036734.1.42595 WP_000036734.1.42603 WP_000036734.1.42605 WP_000036734.1.42650 WP_000036734.1.42655 WP_000036734.1.42666 WP_000036734.1.4267 WP_000036734.1.42675 WP_000036734.1.42676 WP_000036734.1.42683 WP_000036734.1.42685 WP_000036734.1.42701 WP_000036734.1.42707 WP_000036734.1.42734 WP_000036734.1.4276 WP_000036734.1.42767 WP_000036734.1.42794 WP_000036734.1.42797 WP_000036734.1.42805 WP_000036734.1.42815 WP_000036734.1.42829 WP_000036734.1.42859 WP_000036734.1.42861 WP_000036734.1.42864 WP_000036734.1.4288 WP_000036734.1.42887 WP_000036734.1.4289 WP_000036734.1.42892 WP_000036734.1.42923 WP_000036734.1.42932 WP_000036734.1.42957 WP_000036734.1.42978 WP_000036734.1.4298 WP_000036734.1.42981 WP_000036734.1.43008 WP_000036734.1.43016 WP_000036734.1.43018 WP_000036734.1.43019 WP_000036734.1.43041 WP_000036734.1.43065 WP_000036734.1.43068 WP_000036734.1.43069 WP_000036734.1.43070 WP_000036734.1.43077 WP_000036734.1.43086 WP_000036734.1.43089 WP_000036734.1.43126 WP_000036734.1.43128 WP_000036734.1.43141 WP_000036734.1.43157 WP_000036734.1.43160 WP_000036734.1.43161 WP_000036734.1.43190 WP_000036734.1.43198 WP_000036734.1.43201 WP_000036734.1.43244 WP_000036734.1.43258 WP_000036734.1.4326 WP_000036734.1.43272 WP_000036734.1.43276 WP_000036734.1.43290 WP_000036734.1.43292 WP_000036734.1.43299 WP_000036734.1.43307 WP_000036734.1.43312 WP_000036734.1.4332 WP_000036734.1.43334 WP_000036734.1.43339 WP_000036734.1.43351 WP_000036734.1.43371 WP_000036734.1.43437 WP_000036734.1.43438 WP_000036734.1.4344 WP_000036734.1.43441 WP_000036734.1.43476 WP_000036734.1.43508 WP_000036734.1.43513 WP_000036734.1.43520 WP_000036734.1.43522 WP_000036734.1.43535 WP_000036734.1.43606 WP_000036734.1.43613 WP_000036734.1.43633 WP_000036734.1.43637 WP_000036734.1.43651 WP_000036734.1.43654 WP_000036734.1.43668 WP_000036734.1.43676 WP_000036734.1.43685 WP_000036734.1.43710 WP_000036734.1.43711 WP_000036734.1.43722 WP_000036734.1.4373 WP_000036734.1.43763 WP_000036734.1.43778 WP_000036734.1.43782 WP_000036734.1.43785 WP_000036734.1.43801 WP_000036734.1.43812 WP_000036734.1.43828 WP_000036734.1.43839 WP_000036734.1.43864 WP_000036734.1.43873 WP_000036734.1.43875 WP_000036734.1.43878 WP_000036734.1.43886 WP_000036734.1.43888 WP_000036734.1.43919 WP_000036734.1.43951 WP_000036734.1.43954 WP_000036734.1.43974 WP_000036734.1.44005 WP_000036734.1.44010 WP_000036734.1.4404 WP_000036734.1.44043 WP_000036734.1.44049 WP_000036734.1.4405 WP_000036734.1.44063 WP_000036734.1.44099 WP_000036734.1.44101 WP_000036734.1.44113 WP_000036734.1.44121 WP_000036734.1.44132 WP_000036734.1.44144 WP_000036734.1.44160 WP_000036734.1.44180 WP_000036734.1.44187 WP_000036734.1.44191 WP_000036734.1.44196 WP_000036734.1.44208 WP_000036734.1.4422 WP_000036734.1.4423 WP_000036734.1.44248 WP_000036734.1.44250 WP_000036734.1.44262 WP_000036734.1.44268 WP_000036734.1.4427 WP_000036734.1.44291 WP_000036734.1.44296 WP_000036734.1.44300 WP_000036734.1.44310 WP_000036734.1.44337 WP_000036734.1.44339 WP_000036734.1.44343 WP_000036734.1.44351 WP_000036734.1.44359 WP_000036734.1.44360 WP_000036734.1.44380 WP_000036734.1.44386 WP_000036734.1.4440 WP_000036734.1.44416 WP_000036734.1.44431 WP_000036734.1.44433 WP_000036734.1.44437 WP_000036734.1.44438 WP_000036734.1.44440 WP_000036734.1.44443 WP_000036734.1.44453 WP_000036734.1.44474 WP_000036734.1.44479 WP_000036734.1.44546 WP_000036734.1.44549 WP_000036734.1.44578 WP_000036734.1.44593 WP_000036734.1.44606 WP_000036734.1.44607 WP_000036734.1.44633 WP_000036734.1.44636 WP_000036734.1.44640 WP_000036734.1.4467 WP_000036734.1.44678 WP_000036734.1.4468 WP_000036734.1.44687 WP_000036734.1.44702 WP_000036734.1.44705 WP_000036734.1.44747 WP_000036734.1.44762 WP_000036734.1.44781 WP_000036734.1.44791 WP_000036734.1.44795 WP_000036734.1.44815 WP_000036734.1.44828 WP_000036734.1.44831 WP_000036734.1.44833 WP_000036734.1.4485 WP_000036734.1.44877 WP_000036734.1.44879 WP_000036734.1.44887 WP_000036734.1.449 WP_000036734.1.44917 WP_000036734.1.44927 WP_000036734.1.44933 WP_000036734.1.44943 WP_000036734.1.44950 WP_000036734.1.44966 WP_000036734.1.44971 WP_000036734.1.44978 WP_000036734.1.44985 WP_000036734.1.44996 WP_000036734.1.44997 WP_000036734.1.44998 WP_000036734.1.4500 WP_000036734.1.4501 WP_000036734.1.45027 WP_000036734.1.45038 WP_000036734.1.45045 WP_000036734.1.4505 WP_000036734.1.45067 WP_000036734.1.45072 WP_000036734.1.45074 WP_000036734.1.45079 WP_000036734.1.45093 WP_000036734.1.45098 WP_000036734.1.45123 WP_000036734.1.45134 WP_000036734.1.45136 WP_000036734.1.45138 WP_000036734.1.45145 WP_000036734.1.45154 WP_000036734.1.45173 WP_000036734.1.45177 WP_000036734.1.45184 WP_000036734.1.45229 WP_000036734.1.45241 WP_000036734.1.45251 WP_000036734.1.45259 WP_000036734.1.45268 WP_000036734.1.45302 WP_000036734.1.4531 WP_000036734.1.45322 WP_000036734.1.45344 WP_000036734.1.45349 WP_000036734.1.45351 WP_000036734.1.45365 WP_000036734.1.4540 WP_000036734.1.45402 WP_000036734.1.45432 WP_000036734.1.45434 WP_000036734.1.45435 WP_000036734.1.45462 WP_000036734.1.45468 WP_000036734.1.45522 WP_000036734.1.45523 WP_000036734.1.45535 WP_000036734.1.45544 WP_000036734.1.45549 WP_000036734.1.45550 WP_000036734.1.45566 WP_000036734.1.45569 WP_000036734.1.45571 WP_000036734.1.45582 WP_000036734.1.45583 WP_000036734.1.45585 WP_000036734.1.45596 WP_000036734.1.45622 WP_000036734.1.45648 WP_000036734.1.45660 WP_000036734.1.45690 WP_000036734.1.45706 WP_000036734.1.45781 WP_000036734.1.45797 WP_000036734.1.458 WP_000036734.1.45829 WP_000036734.1.45844 WP_000036734.1.45848 WP_000036734.1.45871 WP_000036734.1.45906 WP_000036734.1.45918 WP_000036734.1.45943 WP_000036734.1.45947 WP_000036734.1.45973 WP_000036734.1.45984 WP_000036734.1.46011 WP_000036734.1.46028 WP_000036734.1.46030 WP_000036734.1.46069 WP_000036734.1.46077 WP_000036734.1.46091 WP_000036734.1.46112 WP_000036734.1.46124 WP_000036734.1.46169 WP_000036734.1.46173 WP_000036734.1.46174 WP_000036734.1.46187 WP_000036734.1.46203 WP_000036734.1.46205 WP_000036734.1.46215 WP_000036734.1.46225 WP_000036734.1.46232 WP_000036734.1.46241 WP_000036734.1.46243 WP_000036734.1.46250 WP_000036734.1.46278 WP_000036734.1.46286 WP_000036734.1.46299 WP_000036734.1.46303 WP_000036734.1.46307 WP_000036734.1.46322 WP_000036734.1.46323 WP_000036734.1.46345 WP_000036734.1.46355 WP_000036734.1.46358 WP_000036734.1.464 WP_000036734.1.46406 WP_000036734.1.46434 WP_000036734.1.46444 WP_000036734.1.46454 WP_000036734.1.46461 WP_000036734.1.46499 WP_000036734.1.46504 WP_000036734.1.46505 WP_000036734.1.46551 WP_000036734.1.46559 WP_000036734.1.46572 WP_000036734.1.46578 WP_000036734.1.46595 WP_000036734.1.46620 WP_000036734.1.46637 WP_000036734.1.46666 WP_000036734.1.46675 WP_000036734.1.46689 WP_000036734.1.46693 WP_000036734.1.46701 WP_000036734.1.4671 WP_000036734.1.46726 WP_000036734.1.46730 WP_000036734.1.46732 WP_000036734.1.4674 WP_000036734.1.46749 WP_000036734.1.46781 WP_000036734.1.46803 WP_000036734.1.46804 WP_000036734.1.46816 WP_000036734.1.46842 WP_000036734.1.4686 WP_000036734.1.4690 WP_000036734.1.46920 WP_000036734.1.46930 WP_000036734.1.46945 WP_000036734.1.46961 WP_000036734.1.46967 WP_000036734.1.46975 WP_000036734.1.46976 WP_000036734.1.47005 WP_000036734.1.47008 WP_000036734.1.47014 WP_000036734.1.47023 WP_000036734.1.47036 WP_000036734.1.47037 WP_000036734.1.47042 WP_000036734.1.47057 WP_000036734.1.47058 WP_000036734.1.47059 WP_000036734.1.47061 WP_000036734.1.47067 WP_000036734.1.47085 WP_000036734.1.47123 WP_000036734.1.47214 WP_000036734.1.47215 WP_000036734.1.47243 WP_000036734.1.47245 WP_000036734.1.47257 WP_000036734.1.47389 WP_000036734.1.47429 WP_000036734.1.47442 WP_000036734.1.47448 WP_000036734.1.47460 WP_000036734.1.4747 WP_000036734.1.47472 WP_000036734.1.47478 WP_000036734.1.47482 WP_000036734.1.47492 WP_000036734.1.47506 WP_000036734.1.47507 WP_000036734.1.47523 WP_000036734.1.47531 WP_000036734.1.47532 WP_000036734.1.47542 WP_000036734.1.47567 WP_000036734.1.47576 WP_000036734.1.47579 WP_000036734.1.4758 WP_000036734.1.47587 WP_000036734.1.47605 WP_000036734.1.47614 WP_000036734.1.47621 WP_000036734.1.47630 WP_000036734.1.47649 WP_000036734.1.47660 WP_000036734.1.4769 WP_000036734.1.4770 WP_000036734.1.47714 WP_000036734.1.4774 WP_000036734.1.4775 WP_000036734.1.47756 WP_000036734.1.47767 WP_000036734.1.47799 WP_000036734.1.4781 WP_000036734.1.47814 WP_000036734.1.47817 WP_000036734.1.47829 WP_000036734.1.47849 WP_000036734.1.47850 WP_000036734.1.47875 WP_000036734.1.47886 WP_000036734.1.47898 WP_000036734.1.47902 WP_000036734.1.47911 WP_000036734.1.47928 WP_000036734.1.4795 WP_000036734.1.47988 WP_000036734.1.47992 WP_000036734.1.48019 WP_000036734.1.48033 WP_000036734.1.48100 WP_000036734.1.48114 WP_000036734.1.48124 WP_000036734.1.48132 WP_000036734.1.48134 WP_000036734.1.48139 WP_000036734.1.48190 WP_000036734.1.48209 WP_000036734.1.48215 WP_000036734.1.48218 WP_000036734.1.48242 WP_000036734.1.48244 WP_000036734.1.48247 WP_000036734.1.48253 WP_000036734.1.48262 WP_000036734.1.48292 WP_000036734.1.483 WP_000036734.1.48324 WP_000036734.1.48342 WP_000036734.1.48367 WP_000036734.1.48377 WP_000036734.1.4839 WP_000036734.1.48399 WP_000036734.1.48426 WP_000036734.1.48430 WP_000036734.1.48436 WP_000036734.1.48455 WP_000036734.1.48493 WP_000036734.1.48510 WP_000036734.1.4853 WP_000036734.1.48570 WP_000036734.1.48586 WP_000036734.1.4859 WP_000036734.1.48591 WP_000036734.1.48610 WP_000036734.1.48631 WP_000036734.1.48647 WP_000036734.1.48651 WP_000036734.1.48663 WP_000036734.1.48690 WP_000036734.1.48734 WP_000036734.1.48751 WP_000036734.1.48755 WP_000036734.1.48756 WP_000036734.1.48768 WP_000036734.1.48774 WP_000036734.1.48778 WP_000036734.1.48788 WP_000036734.1.48797 WP_000036734.1.48841 WP_000036734.1.48849 WP_000036734.1.4885 WP_000036734.1.48855 WP_000036734.1.48876 WP_000036734.1.48886 WP_000036734.1.48894 WP_000036734.1.48896 WP_000036734.1.48908 WP_000036734.1.48918 WP_000036734.1.48919 WP_000036734.1.48931 WP_000036734.1.48955 WP_000036734.1.48963 WP_000036734.1.48973 WP_000036734.1.48985 WP_000036734.1.49004 WP_000036734.1.49005 WP_000036734.1.49012 WP_000036734.1.49041 WP_000036734.1.49084 WP_000036734.1.49090 WP_000036734.1.49102 WP_000036734.1.49106 WP_000036734.1.49113 WP_000036734.1.49117 WP_000036734.1.49121 WP_000036734.1.4914 WP_000036734.1.49140 WP_000036734.1.49153 WP_000036734.1.49155 WP_000036734.1.49162 WP_000036734.1.49166 WP_000036734.1.49175 WP_000036734.1.49204 WP_000036734.1.49214 WP_000036734.1.49226 WP_000036734.1.49233 WP_000036734.1.49239 WP_000036734.1.49256 WP_000036734.1.49262 WP_000036734.1.49274 WP_000036734.1.49276 WP_000036734.1.49290 WP_000036734.1.49302 WP_000036734.1.49304 WP_000036734.1.49309 WP_000036734.1.49311 WP_000036734.1.49334 WP_000036734.1.49340 WP_000036734.1.49355 WP_000036734.1.49358 WP_000036734.1.49366 WP_000036734.1.49375 WP_000036734.1.49429 WP_000036734.1.49430 WP_000036734.1.49434 WP_000036734.1.49443 WP_000036734.1.49450 WP_000036734.1.49472 WP_000036734.1.49490 WP_000036734.1.49494 WP_000036734.1.495 WP_000036734.1.49515 WP_000036734.1.49534 WP_000036734.1.49545 WP_000036734.1.49550 WP_000036734.1.49572 WP_000036734.1.49574 WP_000036734.1.49590 WP_000036734.1.49595 WP_000036734.1.49602 WP_000036734.1.49626 WP_000036734.1.49630 WP_000036734.1.49647 WP_000036734.1.49650 WP_000036734.1.49686 WP_000036734.1.49703 WP_000036734.1.49710 WP_000036734.1.49769 WP_000036734.1.49770 WP_000036734.1.49778 WP_000036734.1.49780 WP_000036734.1.4979 WP_000036734.1.49790 WP_000036734.1.49803 WP_000036734.1.49805 WP_000036734.1.49827 WP_000036734.1.49846 WP_000036734.1.49848 WP_000036734.1.4991 WP_000036734.1.49929 WP_000036734.1.49931 WP_000036734.1.49947 WP_000036734.1.49959 WP_000036734.1.49997 WP_000036734.1.50 WP_000036734.1.50003 WP_000036734.1.50007 WP_000036734.1.50014 WP_000036734.1.50030 WP_000036734.1.50043 WP_000036734.1.50080 WP_000036734.1.5009 WP_000036734.1.50103 WP_000036734.1.50128 WP_000036734.1.50153 WP_000036734.1.50158 WP_000036734.1.50161 WP_000036734.1.50198 WP_000036734.1.50211 WP_000036734.1.50238 WP_000036734.1.50239 WP_000036734.1.50247 WP_000036734.1.50251 WP_000036734.1.50285 WP_000036734.1.50308 WP_000036734.1.50309 WP_000036734.1.50332 WP_000036734.1.50349 WP_000036734.1.50374 WP_000036734.1.50376 WP_000036734.1.50386 WP_000036734.1.50387 WP_000036734.1.50389 WP_000036734.1.50404 WP_000036734.1.50406 WP_000036734.1.50413 WP_000036734.1.50449 WP_000036734.1.50468 WP_000036734.1.50469 WP_000036734.1.50478 WP_000036734.1.50480 WP_000036734.1.50497 WP_000036734.1.5051 WP_000036734.1.50517 WP_000036734.1.50529 WP_000036734.1.50563 WP_000036734.1.50565 WP_000036734.1.50566 WP_000036734.1.50570 WP_000036734.1.50576 WP_000036734.1.5058 WP_000036734.1.50593 WP_000036734.1.50626 WP_000036734.1.50652 WP_000036734.1.50676 WP_000036734.1.50684 WP_000036734.1.50726 WP_000036734.1.50750 WP_000036734.1.50769 WP_000036734.1.50771 WP_000036734.1.50774 WP_000036734.1.50777 WP_000036734.1.50782 WP_000036734.1.50800 WP_000036734.1.50804 WP_000036734.1.50808 WP_000036734.1.50811 WP_000036734.1.50875 WP_000036734.1.5088 WP_000036734.1.50882 WP_000036734.1.50885 WP_000036734.1.50893 WP_000036734.1.509 WP_000036734.1.50908 WP_000036734.1.50918 WP_000036734.1.50929 WP_000036734.1.50941 WP_000036734.1.50954 WP_000036734.1.50960 WP_000036734.1.50970 WP_000036734.1.50999 WP_000036734.1.51014 WP_000036734.1.51022 WP_000036734.1.51025 WP_000036734.1.51036 WP_000036734.1.51040 WP_000036734.1.51048 WP_000036734.1.51066 WP_000036734.1.51100 WP_000036734.1.51117 WP_000036734.1.51131 WP_000036734.1.51134 WP_000036734.1.51139 WP_000036734.1.5114 WP_000036734.1.51162 WP_000036734.1.51179 WP_000036734.1.51182 WP_000036734.1.51186 WP_000036734.1.51224 WP_000036734.1.51227 WP_000036734.1.5125 WP_000036734.1.5127 WP_000036734.1.51285 WP_000036734.1.51305 WP_000036734.1.51308 WP_000036734.1.51315 WP_000036734.1.51331 WP_000036734.1.51338 WP_000036734.1.51356 WP_000036734.1.5136 WP_000036734.1.5138 WP_000036734.1.51394 WP_000036734.1.51412 WP_000036734.1.51414 WP_000036734.1.51419 WP_000036734.1.51451 WP_000036734.1.51458 WP_000036734.1.51464 WP_000036734.1.51474 WP_000036734.1.51487 WP_000036734.1.51488 WP_000036734.1.51502 WP_000036734.1.51506 WP_000036734.1.51514 WP_000036734.1.51518 WP_000036734.1.51519 WP_000036734.1.51555 WP_000036734.1.51594 WP_000036734.1.51598 WP_000036734.1.51611 WP_000036734.1.51613 WP_000036734.1.51615 WP_000036734.1.51634 WP_000036734.1.51642 WP_000036734.1.51644 WP_000036734.1.51649 WP_000036734.1.51686 WP_000036734.1.51700 WP_000036734.1.51704 WP_000036734.1.51724 WP_000036734.1.51734 WP_000036734.1.51756 WP_000036734.1.51764 WP_000036734.1.51810 WP_000036734.1.51831 WP_000036734.1.51838 WP_000036734.1.51841 WP_000036734.1.5185 WP_000036734.1.51863 WP_000036734.1.51868 WP_000036734.1.51888 WP_000036734.1.51900 WP_000036734.1.51910 WP_000036734.1.51911 WP_000036734.1.51914 WP_000036734.1.51915 WP_000036734.1.51930 WP_000036734.1.51932 WP_000036734.1.51935 WP_000036734.1.51989 WP_000036734.1.51994 WP_000036734.1.520 WP_000036734.1.52047 WP_000036734.1.52052 WP_000036734.1.52057 WP_000036734.1.52101 WP_000036734.1.5211 WP_000036734.1.52114 WP_000036734.1.52121 WP_000036734.1.52123 WP_000036734.1.52129 WP_000036734.1.52148 WP_000036734.1.52156 WP_000036734.1.5216 WP_000036734.1.52161 WP_000036734.1.52170 WP_000036734.1.52191 WP_000036734.1.52202 WP_000036734.1.52209 WP_000036734.1.52255 WP_000036734.1.52301 WP_000036734.1.52321 WP_000036734.1.52339 WP_000036734.1.52346 WP_000036734.1.52353 WP_000036734.1.52356 WP_000036734.1.52361 WP_000036734.1.52438 WP_000036734.1.52446 WP_000036734.1.52456 WP_000036734.1.52469 WP_000036734.1.52527 WP_000036734.1.52528 WP_000036734.1.52571 WP_000036734.1.52582 WP_000036734.1.52586 WP_000036734.1.526 WP_000036734.1.52608 WP_000036734.1.52637 WP_000036734.1.52647 WP_000036734.1.52653 WP_000036734.1.52656 WP_000036734.1.52675 WP_000036734.1.52692 WP_000036734.1.5273 WP_000036734.1.52738 WP_000036734.1.52742 WP_000036734.1.52743 WP_000036734.1.52744 WP_000036734.1.52748 WP_000036734.1.52773 WP_000036734.1.52795 WP_000036734.1.52807 WP_000036734.1.52824 WP_000036734.1.52833 WP_000036734.1.52851 WP_000036734.1.52857 WP_000036734.1.52858 WP_000036734.1.52866 WP_000036734.1.52887 WP_000036734.1.52898 WP_000036734.1.52910 WP_000036734.1.52915 WP_000036734.1.52924 WP_000036734.1.52949 WP_000036734.1.52985 WP_000036734.1.5301 WP_000036734.1.53016 WP_000036734.1.53092 WP_000036734.1.53100 WP_000036734.1.53107 WP_000036734.1.53119 WP_000036734.1.5313 WP_000036734.1.53141 WP_000036734.1.53151 WP_000036734.1.53154 WP_000036734.1.53158 WP_000036734.1.53159 WP_000036734.1.5316 WP_000036734.1.53179 WP_000036734.1.53190 WP_000036734.1.53198 WP_000036734.1.53203 WP_000036734.1.53206 WP_000036734.1.53210 WP_000036734.1.53233 WP_000036734.1.53234 WP_000036734.1.53272 WP_000036734.1.53274 WP_000036734.1.53286 WP_000036734.1.53307 WP_000036734.1.53315 WP_000036734.1.53316 WP_000036734.1.53321 WP_000036734.1.53328 WP_000036734.1.5333 WP_000036734.1.53362 WP_000036734.1.53368 WP_000036734.1.53375 WP_000036734.1.53385 WP_000036734.1.53406 WP_000036734.1.53436 WP_000036734.1.53450 WP_000036734.1.53454 WP_000036734.1.53466 WP_000036734.1.5349 WP_000036734.1.53529 WP_000036734.1.53534 WP_000036734.1.53540 WP_000036734.1.53543 WP_000036734.1.53555 WP_000036734.1.53559 WP_000036734.1.5356 WP_000036734.1.53567 WP_000036734.1.53571 WP_000036734.1.5358 WP_000036734.1.53664 WP_000036734.1.53675 WP_000036734.1.53688 WP_000036734.1.53692 WP_000036734.1.53694 WP_000036734.1.53696 WP_000036734.1.53723 WP_000036734.1.5374 WP_000036734.1.53750 WP_000036734.1.53757 WP_000036734.1.53772 WP_000036734.1.53778 WP_000036734.1.53781 WP_000036734.1.53790 WP_000036734.1.53800 WP_000036734.1.53812 WP_000036734.1.53814 WP_000036734.1.53815 WP_000036734.1.53839 WP_000036734.1.53892 WP_000036734.1.53896 WP_000036734.1.53898 WP_000036734.1.53902 WP_000036734.1.53905 WP_000036734.1.5392 WP_000036734.1.53935 WP_000036734.1.53958 WP_000036734.1.53961 WP_000036734.1.53981 WP_000036734.1.53984 WP_000036734.1.54033 WP_000036734.1.54061 WP_000036734.1.54068 WP_000036734.1.54075 WP_000036734.1.54082 WP_000036734.1.54085 WP_000036734.1.54132 WP_000036734.1.54136 WP_000036734.1.5415 WP_000036734.1.54159 WP_000036734.1.54170 WP_000036734.1.54175 WP_000036734.1.54196 WP_000036734.1.542 WP_000036734.1.54203 WP_000036734.1.54209 WP_000036734.1.54259 WP_000036734.1.54271 WP_000036734.1.54273 WP_000036734.1.54274 WP_000036734.1.54283 WP_000036734.1.5430 WP_000036734.1.54319 WP_000036734.1.54324 WP_000036734.1.54333 WP_000036734.1.54340 WP_000036734.1.54364 WP_000036734.1.54366 WP_000036734.1.54371 WP_000036734.1.54400 WP_000036734.1.54431 WP_000036734.1.54442 WP_000036734.1.54482 WP_000036734.1.54500 WP_000036734.1.54522 WP_000036734.1.54526 WP_000036734.1.54558 WP_000036734.1.5456 WP_000036734.1.54569 WP_000036734.1.54589 WP_000036734.1.5459 WP_000036734.1.54607 WP_000036734.1.54615 WP_000036734.1.5462 WP_000036734.1.54644 WP_000036734.1.54662 WP_000036734.1.54667 WP_000036734.1.54678 WP_000036734.1.54681 WP_000036734.1.54694 WP_000036734.1.54722 WP_000036734.1.54748 WP_000036734.1.54749 WP_000036734.1.54764 WP_000036734.1.54774 WP_000036734.1.5481 WP_000036734.1.54814 WP_000036734.1.54822 WP_000036734.1.54827 WP_000036734.1.54833 WP_000036734.1.54845 WP_000036734.1.5485 WP_000036734.1.54865 WP_000036734.1.54877 WP_000036734.1.5493 WP_000036734.1.54935 WP_000036734.1.54936 WP_000036734.1.54979 WP_000036734.1.54984 WP_000036734.1.54992 WP_000036734.1.55008 WP_000036734.1.55010 WP_000036734.1.55034 WP_000036734.1.55073 WP_000036734.1.55152 WP_000036734.1.55156 WP_000036734.1.55163 WP_000036734.1.55165 WP_000036734.1.55166 WP_000036734.1.5517 WP_000036734.1.55178 WP_000036734.1.55200 WP_000036734.1.55215 WP_000036734.1.55223 WP_000036734.1.55224 WP_000036734.1.5523 WP_000036734.1.5525 WP_000036734.1.5527 WP_000036734.1.55285 WP_000036734.1.55290 WP_000036734.1.55294 WP_000036734.1.55310 WP_000036734.1.55317 WP_000036734.1.55325 WP_000036734.1.55361 WP_000036734.1.55379 WP_000036734.1.5539 WP_000036734.1.55418 WP_000036734.1.55430 WP_000036734.1.55461 WP_000036734.1.55468 WP_000036734.1.55475 WP_000036734.1.55477 WP_000036734.1.55496 WP_000036734.1.55500 WP_000036734.1.55506 WP_000036734.1.5552 WP_000036734.1.55528 WP_000036734.1.55545 WP_000036734.1.5555 WP_000036734.1.55554 WP_000036734.1.55557 WP_000036734.1.55559 WP_000036734.1.5560 WP_000036734.1.55604 WP_000036734.1.55614 WP_000036734.1.55623 WP_000036734.1.55639 WP_000036734.1.55640 WP_000036734.1.55647 WP_000036734.1.55672 WP_000036734.1.55680 WP_000036734.1.55699 WP_000036734.1.55706 WP_000036734.1.55718 WP_000036734.1.5572 WP_000036734.1.55725 WP_000036734.1.55743 WP_000036734.1.55768 WP_000036734.1.5577 WP_000036734.1.55780 WP_000036734.1.55782 WP_000036734.1.55796 WP_000036734.1.55803 WP_000036734.1.55923 WP_000036734.1.55948 WP_000036734.1.55967 WP_000036734.1.55973 WP_000036734.1.55993 WP_000036734.1.55995 WP_000036734.1.56002 WP_000036734.1.56004 WP_000036734.1.56012 WP_000036734.1.56026 WP_000036734.1.56059 WP_000036734.1.56069 WP_000036734.1.56070 WP_000036734.1.56082 WP_000036734.1.56097 WP_000036734.1.56100 WP_000036734.1.56105 WP_000036734.1.56130 WP_000036734.1.56144 WP_000036734.1.56152 WP_000036734.1.56172 WP_000036734.1.5621 WP_000036734.1.56222 WP_000036734.1.56226 WP_000036734.1.56235 WP_000036734.1.56238 WP_000036734.1.56244 WP_000036734.1.56247 WP_000036734.1.56261 WP_000036734.1.56263 WP_000036734.1.56286 WP_000036734.1.56303 WP_000036734.1.56304 WP_000036734.1.56305 WP_000036734.1.56311 WP_000036734.1.5633 WP_000036734.1.56354 WP_000036734.1.56368 WP_000036734.1.56370 WP_000036734.1.56374 WP_000036734.1.56385 WP_000036734.1.56389 WP_000036734.1.56393 WP_000036734.1.56396 WP_000036734.1.56413 WP_000036734.1.56414 WP_000036734.1.56419 WP_000036734.1.56420 WP_000036734.1.56423 WP_000036734.1.56438 WP_000036734.1.56459 WP_000036734.1.56468 WP_000036734.1.56512 WP_000036734.1.56514 WP_000036734.1.56535 WP_000036734.1.56559 WP_000036734.1.56560 WP_000036734.1.56585 WP_000036734.1.56597 WP_000036734.1.56601 WP_000036734.1.56614 WP_000036734.1.56615 WP_000036734.1.56640 WP_000036734.1.56642 WP_000036734.1.56647 WP_000036734.1.56651 WP_000036734.1.56660 WP_000036734.1.56671 WP_000036734.1.5668 WP_000036734.1.56682 WP_000036734.1.56724 WP_000036734.1.56791 WP_000036734.1.56824 WP_000036734.1.56825 WP_000036734.1.56851 WP_000036734.1.56853 WP_000036734.1.56861 WP_000036734.1.56875 WP_000036734.1.56877 WP_000036734.1.56887 WP_000036734.1.56889 WP_000036734.1.56893 WP_000036734.1.56898 WP_000036734.1.56905 WP_000036734.1.56942 WP_000036734.1.56981 WP_000036734.1.57000 WP_000036734.1.57026 WP_000036734.1.57039 WP_000036734.1.57056 WP_000036734.1.57076 WP_000036734.1.57084 WP_000036734.1.57101 WP_000036734.1.5711 WP_000036734.1.57125 WP_000036734.1.57137 WP_000036734.1.57143 WP_000036734.1.57147 WP_000036734.1.57149 WP_000036734.1.57168 WP_000036734.1.57179 WP_000036734.1.57186 WP_000036734.1.57187 WP_000036734.1.57232 WP_000036734.1.57233 WP_000036734.1.57244 WP_000036734.1.57246 WP_000036734.1.57296 WP_000036734.1.57307 WP_000036734.1.57342 WP_000036734.1.57344 WP_000036734.1.57356 WP_000036734.1.57357 WP_000036734.1.57362 WP_000036734.1.57377 WP_000036734.1.57399 WP_000036734.1.57433 WP_000036734.1.57494 WP_000036734.1.57495 WP_000036734.1.57510 WP_000036734.1.57515 WP_000036734.1.57529 WP_000036734.1.5753 WP_000036734.1.57534 WP_000036734.1.57555 WP_000036734.1.57559 WP_000036734.1.57576 WP_000036734.1.57601 WP_000036734.1.57607 WP_000036734.1.5761 WP_000036734.1.57631 WP_000036734.1.57641 WP_000036734.1.57684 WP_000036734.1.57699 WP_000036734.1.57709 WP_000036734.1.57710 WP_000036734.1.57735 WP_000036734.1.5774 WP_000036734.1.57763 WP_000036734.1.57778 WP_000036734.1.57781 WP_000036734.1.57785 WP_000036734.1.57797 WP_000036734.1.57800 WP_000036734.1.5781 WP_000036734.1.57835 WP_000036734.1.57857 WP_000036734.1.57862 WP_000036734.1.57873 WP_000036734.1.57890 WP_000036734.1.57891 WP_000036734.1.57893 WP_000036734.1.57902 WP_000036734.1.57965 WP_000036734.1.57972 WP_000036734.1.57978 WP_000036734.1.58008 WP_000036734.1.5801 WP_000036734.1.58040 WP_000036734.1.58041 WP_000036734.1.58044 WP_000036734.1.58081 WP_000036734.1.5809 WP_000036734.1.58090 WP_000036734.1.58131 WP_000036734.1.58132 WP_000036734.1.58144 WP_000036734.1.58153 WP_000036734.1.58157 WP_000036734.1.58173 WP_000036734.1.58191 WP_000036734.1.58194 WP_000036734.1.58239 WP_000036734.1.58249 WP_000036734.1.58251 WP_000036734.1.58252 WP_000036734.1.58261 WP_000036734.1.58274 WP_000036734.1.5828 WP_000036734.1.58282 WP_000036734.1.58290 WP_000036734.1.58301 WP_000036734.1.58324 WP_000036734.1.58326 WP_000036734.1.58334 WP_000036734.1.58357 WP_000036734.1.58358 WP_000036734.1.5836 WP_000036734.1.58372 WP_000036734.1.58407 WP_000036734.1.58416 WP_000036734.1.58418 WP_000036734.1.58442 WP_000036734.1.58443 WP_000036734.1.58451 WP_000036734.1.5846 WP_000036734.1.58467 WP_000036734.1.58485 WP_000036734.1.58486 WP_000036734.1.58489 WP_000036734.1.58537 WP_000036734.1.5854 WP_000036734.1.58548 WP_000036734.1.58564 WP_000036734.1.58568 WP_000036734.1.5858 WP_000036734.1.58583 WP_000036734.1.58604 WP_000036734.1.58633 WP_000036734.1.58648 WP_000036734.1.58652 WP_000036734.1.58662 WP_000036734.1.58663 WP_000036734.1.58669 WP_000036734.1.58675 WP_000036734.1.58698 WP_000036734.1.587 WP_000036734.1.58724 WP_000036734.1.58729 WP_000036734.1.58744 WP_000036734.1.58745 WP_000036734.1.5875 WP_000036734.1.5878 WP_000036734.1.58796 WP_000036734.1.58803 WP_000036734.1.58807 WP_000036734.1.58831 WP_000036734.1.58834 WP_000036734.1.58836 WP_000036734.1.58847 WP_000036734.1.5886 WP_000036734.1.58861 WP_000036734.1.58883 WP_000036734.1.58884 WP_000036734.1.58898 WP_000036734.1.58926 WP_000036734.1.58932 WP_000036734.1.58949 WP_000036734.1.58963 WP_000036734.1.58970 WP_000036734.1.58974 WP_000036734.1.59006 WP_000036734.1.59012 WP_000036734.1.59020 WP_000036734.1.59043 WP_000036734.1.59056 WP_000036734.1.59061 WP_000036734.1.59064 WP_000036734.1.59068 WP_000036734.1.5907 WP_000036734.1.59084 WP_000036734.1.59094 WP_000036734.1.59097 WP_000036734.1.59125 WP_000036734.1.59136 WP_000036734.1.59142 WP_000036734.1.59148 WP_000036734.1.59163 WP_000036734.1.59204 WP_000036734.1.59224 WP_000036734.1.59236 WP_000036734.1.59276 WP_000036734.1.59282 WP_000036734.1.5929 WP_000036734.1.59294 WP_000036734.1.59295 WP_000036734.1.59299 WP_000036734.1.59313 WP_000036734.1.59321 WP_000036734.1.59336 WP_000036734.1.59375 WP_000036734.1.59381 WP_000036734.1.59412 WP_000036734.1.59420 WP_000036734.1.59427 WP_000036734.1.59439 WP_000036734.1.59458 WP_000036734.1.59486 WP_000036734.1.5949 WP_000036734.1.59490 WP_000036734.1.59501 WP_000036734.1.59508 WP_000036734.1.59510 WP_000036734.1.59512 WP_000036734.1.59521 WP_000036734.1.5953 WP_000036734.1.59538 WP_000036734.1.59548 WP_000036734.1.59562 WP_000036734.1.59587 WP_000036734.1.59604 WP_000036734.1.59636 WP_000036734.1.59641 WP_000036734.1.59646 WP_000036734.1.59648 WP_000036734.1.59684 WP_000036734.1.5969 WP_000036734.1.59694 WP_000036734.1.59709 WP_000036734.1.59710 WP_000036734.1.59751 WP_000036734.1.59755 WP_000036734.1.59771 WP_000036734.1.5979 WP_000036734.1.59827 WP_000036734.1.59829 WP_000036734.1.59830 WP_000036734.1.59847 WP_000036734.1.59848 WP_000036734.1.59863 WP_000036734.1.59928 WP_000036734.1.5993 WP_000036734.1.59933 WP_000036734.1.59953 WP_000036734.1.59969 WP_000036734.1.59979 WP_000036734.1.59994 WP_000036734.1.60004 WP_000036734.1.60008 WP_000036734.1.60015 WP_000036734.1.60021 WP_000036734.1.60045 WP_000036734.1.60052 WP_000036734.1.60069 WP_000036734.1.60076 WP_000036734.1.60106 WP_000036734.1.60114 WP_000036734.1.60126 WP_000036734.1.60137 WP_000036734.1.60140 WP_000036734.1.60154 WP_000036734.1.60155 WP_000036734.1.60168 WP_000036734.1.60192 WP_000036734.1.60199 WP_000036734.1.60209 WP_000036734.1.60212 WP_000036734.1.60213 WP_000036734.1.60226 WP_000036734.1.60231 WP_000036734.1.60253 WP_000036734.1.60285 WP_000036734.1.60320 WP_000036734.1.60322 WP_000036734.1.60324 WP_000036734.1.6033 WP_000036734.1.60330 WP_000036734.1.60356 WP_000036734.1.60370 WP_000036734.1.60379 WP_000036734.1.6038 WP_000036734.1.60380 WP_000036734.1.6041 WP_000036734.1.60424 WP_000036734.1.60425 WP_000036734.1.60464 WP_000036734.1.60469 WP_000036734.1.60481 WP_000036734.1.60486 WP_000036734.1.605 WP_000036734.1.60503 WP_000036734.1.60507 WP_000036734.1.6052 WP_000036734.1.60545 WP_000036734.1.60560 WP_000036734.1.60561 WP_000036734.1.6058 WP_000036734.1.60584 WP_000036734.1.60597 WP_000036734.1.6060 WP_000036734.1.60608 WP_000036734.1.60622 WP_000036734.1.60643 WP_000036734.1.60661 WP_000036734.1.60676 WP_000036734.1.60708 WP_000036734.1.60713 WP_000036734.1.60725 WP_000036734.1.60746 WP_000036734.1.60760 WP_000036734.1.60772 WP_000036734.1.60783 WP_000036734.1.60792 WP_000036734.1.60794 WP_000036734.1.608 WP_000036734.1.60807 WP_000036734.1.60809 WP_000036734.1.60838 WP_000036734.1.60851 WP_000036734.1.60855 WP_000036734.1.60857 WP_000036734.1.6086 WP_000036734.1.60863 WP_000036734.1.60866 WP_000036734.1.60874 WP_000036734.1.60882 WP_000036734.1.60889 WP_000036734.1.60897 WP_000036734.1.6090 WP_000036734.1.60918 WP_000036734.1.60919 WP_000036734.1.60926 WP_000036734.1.60930 WP_000036734.1.60941 WP_000036734.1.60950 WP_000036734.1.60976 WP_000036734.1.60988 WP_000036734.1.60990 WP_000036734.1.6104 WP_000036734.1.61044 WP_000036734.1.61045 WP_000036734.1.61076 WP_000036734.1.61078 WP_000036734.1.6108 WP_000036734.1.61087 WP_000036734.1.61114 WP_000036734.1.61123 WP_000036734.1.6114 WP_000036734.1.61146 WP_000036734.1.61147 WP_000036734.1.61168 WP_000036734.1.61184 WP_000036734.1.61200 WP_000036734.1.61201 WP_000036734.1.61210 WP_000036734.1.61218 WP_000036734.1.61232 WP_000036734.1.61233 WP_000036734.1.6126 WP_000036734.1.6129 WP_000036734.1.61296 WP_000036734.1.61309 WP_000036734.1.61345 WP_000036734.1.61356 WP_000036734.1.61357 WP_000036734.1.61381 WP_000036734.1.61417 WP_000036734.1.6143 WP_000036734.1.61434 WP_000036734.1.61497 WP_000036734.1.61501 WP_000036734.1.61509 WP_000036734.1.61511 WP_000036734.1.61519 WP_000036734.1.61539 WP_000036734.1.61542 WP_000036734.1.61553 WP_000036734.1.61574 WP_000036734.1.61582 WP_000036734.1.61594 WP_000036734.1.61595 WP_000036734.1.61609 WP_000036734.1.6164 WP_000036734.1.61649 WP_000036734.1.61652 WP_000036734.1.61662 WP_000036734.1.61671 WP_000036734.1.61694 WP_000036734.1.61697 WP_000036734.1.61712 WP_000036734.1.61714 WP_000036734.1.61730 WP_000036734.1.61732 WP_000036734.1.61737 WP_000036734.1.61743 WP_000036734.1.61783 WP_000036734.1.61809 WP_000036734.1.61857 WP_000036734.1.61877 WP_000036734.1.6190 WP_000036734.1.61908 WP_000036734.1.61918 WP_000036734.1.61920 WP_000036734.1.61922 WP_000036734.1.61924 WP_000036734.1.61952 WP_000036734.1.61968 WP_000036734.1.62007 WP_000036734.1.62020 WP_000036734.1.62025 WP_000036734.1.62063 WP_000036734.1.6209 WP_000036734.1.6210 WP_000036734.1.62108 WP_000036734.1.62120 WP_000036734.1.62122 WP_000036734.1.62124 WP_000036734.1.62142 WP_000036734.1.62144 WP_000036734.1.62158 WP_000036734.1.62184 WP_000036734.1.62195 WP_000036734.1.62199 WP_000036734.1.62201 WP_000036734.1.62204 WP_000036734.1.62210 WP_000036734.1.62222 WP_000036734.1.62223 WP_000036734.1.62241 WP_000036734.1.62257 WP_000036734.1.62271 WP_000036734.1.62302 WP_000036734.1.62304 WP_000036734.1.62310 WP_000036734.1.62314 WP_000036734.1.62323 WP_000036734.1.62333 WP_000036734.1.62338 WP_000036734.1.62339 WP_000036734.1.62344 WP_000036734.1.62361 WP_000036734.1.62364 WP_000036734.1.62374 WP_000036734.1.62380 WP_000036734.1.62403 WP_000036734.1.62404 WP_000036734.1.62407 WP_000036734.1.62411 WP_000036734.1.62412 WP_000036734.1.62436 WP_000036734.1.62475 WP_000036734.1.62486 WP_000036734.1.62488 WP_000036734.1.62504 WP_000036734.1.62522 WP_000036734.1.6253 WP_000036734.1.62536 WP_000036734.1.62564 WP_000036734.1.62570 WP_000036734.1.62619 WP_000036734.1.62640 WP_000036734.1.62648 WP_000036734.1.62669 WP_000036734.1.62677 WP_000036734.1.62686 WP_000036734.1.62693 WP_000036734.1.627 WP_000036734.1.62725 WP_000036734.1.62745 WP_000036734.1.62751 WP_000036734.1.62757 WP_000036734.1.62798 WP_000036734.1.62825 WP_000036734.1.62828 WP_000036734.1.62853 WP_000036734.1.62903 WP_000036734.1.62910 WP_000036734.1.62913 WP_000036734.1.6292 WP_000036734.1.62932 WP_000036734.1.62955 WP_000036734.1.62960 WP_000036734.1.62976 WP_000036734.1.62983 WP_000036734.1.62988 WP_000036734.1.63016 WP_000036734.1.63025 WP_000036734.1.63043 WP_000036734.1.63045 WP_000036734.1.63063 WP_000036734.1.63069 WP_000036734.1.63087 WP_000036734.1.63102 WP_000036734.1.63118 WP_000036734.1.63129 WP_000036734.1.63135 WP_000036734.1.63150 WP_000036734.1.63155 WP_000036734.1.63169 WP_000036734.1.63181 WP_000036734.1.63186 WP_000036734.1.63203 WP_000036734.1.63229 WP_000036734.1.63234 WP_000036734.1.63243 WP_000036734.1.63250 WP_000036734.1.63256 WP_000036734.1.63290 WP_000036734.1.63297 WP_000036734.1.63358 WP_000036734.1.63362 WP_000036734.1.63382 WP_000036734.1.63422 WP_000036734.1.63432 WP_000036734.1.63448 WP_000036734.1.63455 WP_000036734.1.63461 WP_000036734.1.63479 WP_000036734.1.63497 WP_000036734.1.63499 WP_000036734.1.63509 WP_000036734.1.63513 WP_000036734.1.63514 WP_000036734.1.63525 WP_000036734.1.63529 WP_000036734.1.63532 WP_000036734.1.63548 WP_000036734.1.63568 WP_000036734.1.6357 WP_000036734.1.63577 WP_000036734.1.63583 WP_000036734.1.63585 WP_000036734.1.63592 WP_000036734.1.63603 WP_000036734.1.63633 WP_000036734.1.63663 WP_000036734.1.63664 WP_000036734.1.6367 WP_000036734.1.63677 WP_000036734.1.63690 WP_000036734.1.6370 WP_000036734.1.63718 WP_000036734.1.63731 WP_000036734.1.63736 WP_000036734.1.63748 WP_000036734.1.6375 WP_000036734.1.63757 WP_000036734.1.63766 WP_000036734.1.63781 WP_000036734.1.63782 WP_000036734.1.63797 WP_000036734.1.63816 WP_000036734.1.63824 WP_000036734.1.63831 WP_000036734.1.63834 WP_000036734.1.6384 WP_000036734.1.63851 WP_000036734.1.63860 WP_000036734.1.63863 WP_000036734.1.63864 WP_000036734.1.63866 WP_000036734.1.63876 WP_000036734.1.6389 WP_000036734.1.63901 WP_000036734.1.63903 WP_000036734.1.63912 WP_000036734.1.63934 WP_000036734.1.63955 WP_000036734.1.63958 WP_000036734.1.63963 WP_000036734.1.63977 WP_000036734.1.6399 WP_000036734.1.63992 WP_000036734.1.64007 WP_000036734.1.64010 WP_000036734.1.64018 WP_000036734.1.64032 WP_000036734.1.64034 WP_000036734.1.64036 WP_000036734.1.64046 WP_000036734.1.64072 WP_000036734.1.64085 WP_000036734.1.64087 WP_000036734.1.64109 WP_000036734.1.6415 WP_000036734.1.64157 WP_000036734.1.64176 WP_000036734.1.64208 WP_000036734.1.64229 WP_000036734.1.6423 WP_000036734.1.64242 WP_000036734.1.64244 WP_000036734.1.64266 WP_000036734.1.64293 WP_000036734.1.64294 WP_000036734.1.64332 WP_000036734.1.64350 WP_000036734.1.6437 WP_000036734.1.64374 WP_000036734.1.64376 WP_000036734.1.64385 WP_000036734.1.64387 WP_000036734.1.64389 WP_000036734.1.644 WP_000036734.1.64403 WP_000036734.1.64412 WP_000036734.1.64462 WP_000036734.1.64471 WP_000036734.1.64500 WP_000036734.1.64501 WP_000036734.1.6451 WP_000036734.1.64538 WP_000036734.1.64569 WP_000036734.1.64597 WP_000036734.1.64632 WP_000036734.1.64645 WP_000036734.1.64648 WP_000036734.1.64649 WP_000036734.1.64654 WP_000036734.1.64662 WP_000036734.1.64663 WP_000036734.1.64667 WP_000036734.1.64674 WP_000036734.1.64690 WP_000036734.1.64702 WP_000036734.1.64709 WP_000036734.1.64710 WP_000036734.1.64711 WP_000036734.1.64715 WP_000036734.1.64721 WP_000036734.1.64744 WP_000036734.1.64757 WP_000036734.1.64758 WP_000036734.1.64763 WP_000036734.1.64771 WP_000036734.1.64781 WP_000036734.1.64798 WP_000036734.1.64817 WP_000036734.1.64831 WP_000036734.1.64847 WP_000036734.1.6487 WP_000036734.1.6489 WP_000036734.1.64891 WP_000036734.1.64894 WP_000036734.1.64919 WP_000036734.1.64920 WP_000036734.1.64944 WP_000036734.1.64972 WP_000036734.1.64974 WP_000036734.1.64977 WP_000036734.1.65011 WP_000036734.1.65016 WP_000036734.1.65018 WP_000036734.1.65022 WP_000036734.1.65027 WP_000036734.1.65028 WP_000036734.1.65052 WP_000036734.1.65054 WP_000036734.1.65075 WP_000036734.1.6514 WP_000036734.1.65163 WP_000036734.1.65168 WP_000036734.1.65171 WP_000036734.1.65172 WP_000036734.1.65185 WP_000036734.1.65191 WP_000036734.1.65200 WP_000036734.1.65211 WP_000036734.1.65218 WP_000036734.1.65226 WP_000036734.1.65238 WP_000036734.1.65248 WP_000036734.1.65249 WP_000036734.1.6525 WP_000036734.1.65266 WP_000036734.1.65269 WP_000036734.1.65295 WP_000036734.1.65308 WP_000036734.1.65348 WP_000036734.1.6535 WP_000036734.1.65357 WP_000036734.1.65363 WP_000036734.1.65394 WP_000036734.1.65395 WP_000036734.1.65437 WP_000036734.1.65459 WP_000036734.1.65463 WP_000036734.1.65471 WP_000036734.1.65474 WP_000036734.1.65475 WP_000036734.1.65487 WP_000036734.1.6549 WP_000036734.1.65499 WP_000036734.1.6550 WP_000036734.1.65508 WP_000036734.1.65538 WP_000036734.1.6554 WP_000036734.1.65558 WP_000036734.1.65572 WP_000036734.1.6558 WP_000036734.1.6560 WP_000036734.1.65601 WP_000036734.1.6561 WP_000036734.1.65620 WP_000036734.1.65633 WP_000036734.1.6565 WP_000036734.1.65650 WP_000036734.1.65687 WP_000036734.1.65696 WP_000036734.1.65697 WP_000036734.1.65698 WP_000036734.1.65699 WP_000036734.1.6572 WP_000036734.1.65737 WP_000036734.1.6575 WP_000036734.1.65755 WP_000036734.1.65771 WP_000036734.1.65782 WP_000036734.1.65790 WP_000036734.1.65795 WP_000036734.1.65812 WP_000036734.1.65818 WP_000036734.1.65838 WP_000036734.1.65846 WP_000036734.1.65849 WP_000036734.1.65863 WP_000036734.1.65876 WP_000036734.1.65881 WP_000036734.1.65883 WP_000036734.1.65901 WP_000036734.1.6594 WP_000036734.1.65940 WP_000036734.1.6595 WP_000036734.1.65956 WP_000036734.1.65968 WP_000036734.1.65985 WP_000036734.1.66021 WP_000036734.1.66031 WP_000036734.1.66049 WP_000036734.1.66052 WP_000036734.1.66064 WP_000036734.1.66074 WP_000036734.1.66082 WP_000036734.1.66085 WP_000036734.1.66109 WP_000036734.1.66129 WP_000036734.1.66145 WP_000036734.1.66167 WP_000036734.1.66171 WP_000036734.1.66183 WP_000036734.1.6620 WP_000036734.1.66216 WP_000036734.1.66234 WP_000036734.1.66235 WP_000036734.1.66250 WP_000036734.1.66270 WP_000036734.1.66272 WP_000036734.1.66273 WP_000036734.1.6630 WP_000036734.1.66314 WP_000036734.1.66315 WP_000036734.1.66324 WP_000036734.1.66330 WP_000036734.1.6634 WP_000036734.1.66358 WP_000036734.1.66361 WP_000036734.1.66362 WP_000036734.1.66365 WP_000036734.1.66368 WP_000036734.1.6638 WP_000036734.1.66385 WP_000036734.1.6640 WP_000036734.1.66400 WP_000036734.1.66428 WP_000036734.1.66446 WP_000036734.1.66462 WP_000036734.1.6647 WP_000036734.1.66480 WP_000036734.1.66492 WP_000036734.1.66506 WP_000036734.1.66534 WP_000036734.1.66539 WP_000036734.1.66600 WP_000036734.1.66630 WP_000036734.1.66665 WP_000036734.1.66678 WP_000036734.1.66681 WP_000036734.1.66684 WP_000036734.1.66698 WP_000036734.1.66702 WP_000036734.1.66733 WP_000036734.1.66755 WP_000036734.1.66759 WP_000036734.1.66779 WP_000036734.1.6680 WP_000036734.1.66800 WP_000036734.1.66801 WP_000036734.1.66807 WP_000036734.1.66820 WP_000036734.1.66824 WP_000036734.1.66825 WP_000036734.1.66834 WP_000036734.1.66860 WP_000036734.1.66876 WP_000036734.1.66901 WP_000036734.1.6692 WP_000036734.1.66953 WP_000036734.1.66955 WP_000036734.1.66959 WP_000036734.1.66962 WP_000036734.1.66981 WP_000036734.1.67 WP_000036734.1.67024 WP_000036734.1.67037 WP_000036734.1.67042 WP_000036734.1.67045 WP_000036734.1.67075 WP_000036734.1.6710 WP_000036734.1.67100 WP_000036734.1.67101 WP_000036734.1.67143 WP_000036734.1.67173 WP_000036734.1.67175 WP_000036734.1.67181 WP_000036734.1.67184 WP_000036734.1.67201 WP_000036734.1.67211 WP_000036734.1.67228 WP_000036734.1.67235 WP_000036734.1.67237 WP_000036734.1.67268 WP_000036734.1.67279 WP_000036734.1.67288 WP_000036734.1.67336 WP_000036734.1.67339 WP_000036734.1.67347 WP_000036734.1.67374 WP_000036734.1.67387 WP_000036734.1.6739 WP_000036734.1.67394 WP_000036734.1.67397 WP_000036734.1.67403 WP_000036734.1.67405 WP_000036734.1.67424 WP_000036734.1.67430 WP_000036734.1.67442 WP_000036734.1.67465 WP_000036734.1.67539 WP_000036734.1.67552 WP_000036734.1.67556 WP_000036734.1.67576 WP_000036734.1.6760 WP_000036734.1.67603 WP_000036734.1.67604 WP_000036734.1.67617 WP_000036734.1.67619 WP_000036734.1.67623 WP_000036734.1.67625 WP_000036734.1.67627 WP_000036734.1.67633 WP_000036734.1.67637 WP_000036734.1.67641 WP_000036734.1.67657 WP_000036734.1.67673 WP_000036734.1.67682 WP_000036734.1.67700 WP_000036734.1.67707 WP_000036734.1.67718 WP_000036734.1.67729 WP_000036734.1.67731 WP_000036734.1.67772 WP_000036734.1.67774 WP_000036734.1.67776 WP_000036734.1.67803 WP_000036734.1.67814 WP_000036734.1.6782 WP_000036734.1.67820 WP_000036734.1.67825 WP_000036734.1.67827 WP_000036734.1.67829 WP_000036734.1.6785 WP_000036734.1.67887 WP_000036734.1.67905 WP_000036734.1.67910 WP_000036734.1.67924 WP_000036734.1.67932 WP_000036734.1.67942 WP_000036734.1.67954 WP_000036734.1.67969 WP_000036734.1.67970 WP_000036734.1.67977 WP_000036734.1.67988 WP_000036734.1.68 WP_000036734.1.68036 WP_000036734.1.68043 WP_000036734.1.68073 WP_000036734.1.68075 WP_000036734.1.6809 WP_000036734.1.68105 WP_000036734.1.68113 WP_000036734.1.68115 WP_000036734.1.68131 WP_000036734.1.68140 WP_000036734.1.68147 WP_000036734.1.68159 WP_000036734.1.68167 WP_000036734.1.68182 WP_000036734.1.6819 WP_000036734.1.68201 WP_000036734.1.68206 WP_000036734.1.68210 WP_000036734.1.6827 WP_000036734.1.68275 WP_000036734.1.68285 WP_000036734.1.6833 WP_000036734.1.68359 WP_000036734.1.68401 WP_000036734.1.68420 WP_000036734.1.68477 WP_000036734.1.68478 WP_000036734.1.6849 WP_000036734.1.685 WP_000036734.1.68514 WP_000036734.1.68532 WP_000036734.1.68547 WP_000036734.1.68564 WP_000036734.1.6857 WP_000036734.1.6858 WP_000036734.1.68589 WP_000036734.1.68591 WP_000036734.1.68629 WP_000036734.1.68652 WP_000036734.1.68655 WP_000036734.1.68656 WP_000036734.1.68658 WP_000036734.1.68677 WP_000036734.1.68688 WP_000036734.1.6869 WP_000036734.1.68690 WP_000036734.1.68742 WP_000036734.1.6875 WP_000036734.1.68770 WP_000036734.1.68778 WP_000036734.1.68787 WP_000036734.1.6879 WP_000036734.1.68809 WP_000036734.1.68816 WP_000036734.1.68818 WP_000036734.1.6882 WP_000036734.1.6883 WP_000036734.1.68893 WP_000036734.1.68894 WP_000036734.1.68895 WP_000036734.1.68914 WP_000036734.1.68928 WP_000036734.1.68958 WP_000036734.1.68966 WP_000036734.1.68975 WP_000036734.1.68999 WP_000036734.1.69001 WP_000036734.1.69006 WP_000036734.1.69011 WP_000036734.1.69029 WP_000036734.1.6904 WP_000036734.1.69042 WP_000036734.1.6905 WP_000036734.1.69053 WP_000036734.1.69058 WP_000036734.1.6907 WP_000036734.1.69080 WP_000036734.1.69086 WP_000036734.1.6913 WP_000036734.1.69131 WP_000036734.1.69139 WP_000036734.1.69146 WP_000036734.1.69151 WP_000036734.1.69170 WP_000036734.1.69210 WP_000036734.1.69236 WP_000036734.1.69255 WP_000036734.1.69270 WP_000036734.1.69273 WP_000036734.1.69282 WP_000036734.1.69288 WP_000036734.1.69296 WP_000036734.1.69320 WP_000036734.1.69346 WP_000036734.1.69357 WP_000036734.1.69359 WP_000036734.1.69371 WP_000036734.1.69376 WP_000036734.1.69385 WP_000036734.1.69396 WP_000036734.1.69397 WP_000036734.1.69433 WP_000036734.1.69465 WP_000036734.1.69466 WP_000036734.1.69485 WP_000036734.1.69515 WP_000036734.1.6954 WP_000036734.1.69554 WP_000036734.1.69564 WP_000036734.1.69575 WP_000036734.1.69588 WP_000036734.1.69592 WP_000036734.1.69597 WP_000036734.1.69611 WP_000036734.1.69616 WP_000036734.1.69636 WP_000036734.1.69642 WP_000036734.1.69644 WP_000036734.1.69656 WP_000036734.1.69657 WP_000036734.1.69690 WP_000036734.1.69696 WP_000036734.1.69704 WP_000036734.1.69710 WP_000036734.1.69754 WP_000036734.1.69758 WP_000036734.1.69760 WP_000036734.1.69767 WP_000036734.1.69785 WP_000036734.1.69787 WP_000036734.1.69790 WP_000036734.1.69807 WP_000036734.1.69808 WP_000036734.1.69817 WP_000036734.1.69839 WP_000036734.1.69848 WP_000036734.1.69890 WP_000036734.1.69923 WP_000036734.1.69948 WP_000036734.1.69953 WP_000036734.1.69965 WP_000036734.1.69975 WP_000036734.1.69977 WP_000036734.1.69982 WP_000036734.1.70003 WP_000036734.1.70010 WP_000036734.1.70028 WP_000036734.1.70047 WP_000036734.1.70049 WP_000036734.1.70058 WP_000036734.1.70061 WP_000036734.1.70087 WP_000036734.1.70088 WP_000036734.1.7010 WP_000036734.1.7014 WP_000036734.1.7016 WP_000036734.1.70169 WP_000036734.1.70205 WP_000036734.1.7021 WP_000036734.1.70240 WP_000036734.1.70241 WP_000036734.1.70248 WP_000036734.1.70249 WP_000036734.1.70261 WP_000036734.1.70262 WP_000036734.1.70269 WP_000036734.1.70272 WP_000036734.1.70281 WP_000036734.1.70289 WP_000036734.1.70290 WP_000036734.1.70314 WP_000036734.1.70321 WP_000036734.1.70326 WP_000036734.1.70327 WP_000036734.1.7033 WP_000036734.1.70355 WP_000036734.1.70427 WP_000036734.1.70433 WP_000036734.1.7044 WP_000036734.1.70440 WP_000036734.1.70447 WP_000036734.1.70485 WP_000036734.1.70488 WP_000036734.1.70491 WP_000036734.1.70523 WP_000036734.1.70531 WP_000036734.1.70545 WP_000036734.1.70547 WP_000036734.1.7055 WP_000036734.1.70580 WP_000036734.1.70596 WP_000036734.1.7060 WP_000036734.1.70623 WP_000036734.1.70643 WP_000036734.1.70644 WP_000036734.1.70662 WP_000036734.1.70671 WP_000036734.1.70678 WP_000036734.1.70679 WP_000036734.1.70683 WP_000036734.1.70685 WP_000036734.1.70692 WP_000036734.1.70708 WP_000036734.1.70712 WP_000036734.1.70717 WP_000036734.1.70731 WP_000036734.1.70732 WP_000036734.1.70733 WP_000036734.1.70761 WP_000036734.1.70772 WP_000036734.1.70785 WP_000036734.1.70792 WP_000036734.1.70797 WP_000036734.1.70837 WP_000036734.1.70845 WP_000036734.1.70846 WP_000036734.1.70869 WP_000036734.1.70883 WP_000036734.1.70899 WP_000036734.1.70914 WP_000036734.1.70922 WP_000036734.1.7093 WP_000036734.1.70948 WP_000036734.1.70959 WP_000036734.1.70969 WP_000036734.1.70971 WP_000036734.1.70981 WP_000036734.1.70985 WP_000036734.1.70986 WP_000036734.1.70995 WP_000036734.1.71007 WP_000036734.1.71010 WP_000036734.1.71023 WP_000036734.1.71039 WP_000036734.1.71057 WP_000036734.1.71069 WP_000036734.1.71081 WP_000036734.1.71088 WP_000036734.1.7110 WP_000036734.1.71116 WP_000036734.1.71117 WP_000036734.1.71120 WP_000036734.1.71146 WP_000036734.1.71150 WP_000036734.1.71165 WP_000036734.1.71171 WP_000036734.1.71172 WP_000036734.1.71184 WP_000036734.1.71186 WP_000036734.1.71188 WP_000036734.1.71201 WP_000036734.1.71202 WP_000036734.1.71243 WP_000036734.1.71245 WP_000036734.1.71248 WP_000036734.1.71268 WP_000036734.1.71299 WP_000036734.1.71305 WP_000036734.1.71306 WP_000036734.1.71337 WP_000036734.1.7134 WP_000036734.1.71363 WP_000036734.1.71368 WP_000036734.1.71378 WP_000036734.1.714 WP_000036734.1.71401 WP_000036734.1.71407 WP_000036734.1.71418 WP_000036734.1.7142 WP_000036734.1.71446 WP_000036734.1.71450 WP_000036734.1.71452 WP_000036734.1.71455 WP_000036734.1.71456 WP_000036734.1.71481 WP_000036734.1.71487 WP_000036734.1.71500 WP_000036734.1.71523 WP_000036734.1.71542 WP_000036734.1.71566 WP_000036734.1.71583 WP_000036734.1.71626 WP_000036734.1.71636 WP_000036734.1.71640 WP_000036734.1.71649 WP_000036734.1.71651 WP_000036734.1.71653 WP_000036734.1.71656 WP_000036734.1.71658 WP_000036734.1.71667 WP_000036734.1.71691 WP_000036734.1.71702 WP_000036734.1.71716 WP_000036734.1.7174 WP_000036734.1.71746 WP_000036734.1.71750 WP_000036734.1.71756 WP_000036734.1.71793 WP_000036734.1.71798 WP_000036734.1.71845 WP_000036734.1.71848 WP_000036734.1.71872 WP_000036734.1.71881 WP_000036734.1.71908 WP_000036734.1.71923 WP_000036734.1.71929 WP_000036734.1.71941 WP_000036734.1.71950 WP_000036734.1.71952 WP_000036734.1.71954 WP_000036734.1.71973 WP_000036734.1.71979 WP_000036734.1.71984 WP_000036734.1.71985 WP_000036734.1.720 WP_000036734.1.72003 WP_000036734.1.72065 WP_000036734.1.72068 WP_000036734.1.72073 WP_000036734.1.72100 WP_000036734.1.72105 WP_000036734.1.72107 WP_000036734.1.72119 WP_000036734.1.72121 WP_000036734.1.72188 WP_000036734.1.72190 WP_000036734.1.72203 WP_000036734.1.72220 WP_000036734.1.72221 WP_000036734.1.72226 WP_000036734.1.72234 WP_000036734.1.72243 WP_000036734.1.72254 WP_000036734.1.72269 WP_000036734.1.72277 WP_000036734.1.72281 WP_000036734.1.72283 WP_000036734.1.72300 WP_000036734.1.72307 WP_000036734.1.72325 WP_000036734.1.72339 WP_000036734.1.72350 WP_000036734.1.72351 WP_000036734.1.72372 WP_000036734.1.72376 WP_000036734.1.72382 WP_000036734.1.72383 WP_000036734.1.72399 WP_000036734.1.72403 WP_000036734.1.72412 WP_000036734.1.7243 WP_000036734.1.72438 WP_000036734.1.72461 WP_000036734.1.72527 WP_000036734.1.72532 WP_000036734.1.7255 WP_000036734.1.72594 WP_000036734.1.72602 WP_000036734.1.72629 WP_000036734.1.72631 WP_000036734.1.72638 WP_000036734.1.72642 WP_000036734.1.72667 WP_000036734.1.72671 WP_000036734.1.72674 WP_000036734.1.72689 WP_000036734.1.72716 WP_000036734.1.72718 WP_000036734.1.72724 WP_000036734.1.72728 WP_000036734.1.72789 WP_000036734.1.72793 WP_000036734.1.72797 WP_000036734.1.72827 WP_000036734.1.72828 WP_000036734.1.72843 WP_000036734.1.72850 WP_000036734.1.72865 WP_000036734.1.72871 WP_000036734.1.72872 WP_000036734.1.72887 WP_000036734.1.72892 WP_000036734.1.72894 WP_000036734.1.72896 WP_000036734.1.72897 WP_000036734.1.72944 WP_000036734.1.72946 WP_000036734.1.7295 WP_000036734.1.72968 WP_000036734.1.72969 WP_000036734.1.72975 WP_000036734.1.72987 WP_000036734.1.7304 WP_000036734.1.73052 WP_000036734.1.73062 WP_000036734.1.73068 WP_000036734.1.73102 WP_000036734.1.7311 WP_000036734.1.73114 WP_000036734.1.73125 WP_000036734.1.73144 WP_000036734.1.7315 WP_000036734.1.7316 WP_000036734.1.73164 WP_000036734.1.73177 WP_000036734.1.73180 WP_000036734.1.73200 WP_000036734.1.73242 WP_000036734.1.73258 WP_000036734.1.73270 WP_000036734.1.73285 WP_000036734.1.7332 WP_000036734.1.73328 WP_000036734.1.7333 WP_000036734.1.73338 WP_000036734.1.7334 WP_000036734.1.73352 WP_000036734.1.73362 WP_000036734.1.73377 WP_000036734.1.73379 WP_000036734.1.73389 WP_000036734.1.7341 WP_000036734.1.73425 WP_000036734.1.73461 WP_000036734.1.73481 WP_000036734.1.73488 WP_000036734.1.73504 WP_000036734.1.73512 WP_000036734.1.7353 WP_000036734.1.73535 WP_000036734.1.73544 WP_000036734.1.7356 WP_000036734.1.73561 WP_000036734.1.73581 WP_000036734.1.73596 WP_000036734.1.73598 WP_000036734.1.7361 WP_000036734.1.73617 WP_000036734.1.73648 WP_000036734.1.73667 WP_000036734.1.73669 WP_000036734.1.73701 WP_000036734.1.73708 WP_000036734.1.7374 WP_000036734.1.73753 WP_000036734.1.73758 WP_000036734.1.73768 WP_000036734.1.73794 WP_000036734.1.73804 WP_000036734.1.73831 WP_000036734.1.73847 WP_000036734.1.73849 WP_000036734.1.7386 WP_000036734.1.7387 WP_000036734.1.73901 WP_000036734.1.73924 WP_000036734.1.73926 WP_000036734.1.7394 WP_000036734.1.73945 WP_000036734.1.73948 WP_000036734.1.73956 WP_000036734.1.73958 WP_000036734.1.73965 WP_000036734.1.73999 WP_000036734.1.74024 WP_000036734.1.74028 WP_000036734.1.74029 WP_000036734.1.74030 WP_000036734.1.74038 WP_000036734.1.74040 WP_000036734.1.74043 WP_000036734.1.74049 WP_000036734.1.7405 WP_000036734.1.74058 WP_000036734.1.74070 WP_000036734.1.74077 WP_000036734.1.74089 WP_000036734.1.74117 WP_000036734.1.74135 WP_000036734.1.74163 WP_000036734.1.74174 WP_000036734.1.74181 WP_000036734.1.74191 WP_000036734.1.74207 WP_000036734.1.74214 WP_000036734.1.74228 WP_000036734.1.74241 WP_000036734.1.74248 WP_000036734.1.74285 WP_000036734.1.743 WP_000036734.1.7430 WP_000036734.1.74300 WP_000036734.1.74317 WP_000036734.1.7433 WP_000036734.1.74379 WP_000036734.1.74402 WP_000036734.1.74410 WP_000036734.1.74414 WP_000036734.1.74415 WP_000036734.1.74418 WP_000036734.1.74422 WP_000036734.1.74428 WP_000036734.1.7444 WP_000036734.1.74454 WP_000036734.1.74466 WP_000036734.1.74469 WP_000036734.1.74481 WP_000036734.1.745 WP_000036734.1.74500 WP_000036734.1.74529 WP_000036734.1.74545 WP_000036734.1.74570 WP_000036734.1.74578 WP_000036734.1.7458 WP_000036734.1.74616 WP_000036734.1.74620 WP_000036734.1.74621 WP_000036734.1.74632 WP_000036734.1.74639 WP_000036734.1.74644 WP_000036734.1.74647 WP_000036734.1.74661 WP_000036734.1.74673 WP_000036734.1.74677 WP_000036734.1.74699 WP_000036734.1.74702 WP_000036734.1.74741 WP_000036734.1.74745 WP_000036734.1.74757 WP_000036734.1.74806 WP_000036734.1.74807 WP_000036734.1.74826 WP_000036734.1.74831 WP_000036734.1.74876 WP_000036734.1.74884 WP_000036734.1.74894 WP_000036734.1.7491 WP_000036734.1.74929 WP_000036734.1.74939 WP_000036734.1.74946 WP_000036734.1.74972 WP_000036734.1.74973 WP_000036734.1.74992 WP_000036734.1.74996 WP_000036734.1.75009 WP_000036734.1.75051 WP_000036734.1.75056 WP_000036734.1.75058 WP_000036734.1.7507 WP_000036734.1.75089 WP_000036734.1.75114 WP_000036734.1.75116 WP_000036734.1.75129 WP_000036734.1.75134 WP_000036734.1.75148 WP_000036734.1.75150 WP_000036734.1.75159 WP_000036734.1.75168 WP_000036734.1.75177 WP_000036734.1.75180 WP_000036734.1.75187 WP_000036734.1.75237 WP_000036734.1.75273 WP_000036734.1.75288 WP_000036734.1.75296 WP_000036734.1.75301 WP_000036734.1.7531 WP_000036734.1.75334 WP_000036734.1.75362 WP_000036734.1.75371 WP_000036734.1.75385 WP_000036734.1.75392 WP_000036734.1.75400 WP_000036734.1.75402 WP_000036734.1.75413 WP_000036734.1.7543 WP_000036734.1.75433 WP_000036734.1.75450 WP_000036734.1.75494 WP_000036734.1.75532 WP_000036734.1.75565 WP_000036734.1.7558 WP_000036734.1.75585 WP_000036734.1.75593 WP_000036734.1.75607 WP_000036734.1.75609 WP_000036734.1.75610 WP_000036734.1.75626 WP_000036734.1.75633 WP_000036734.1.75664 WP_000036734.1.75703 WP_000036734.1.75716 WP_000036734.1.75718 WP_000036734.1.75740 WP_000036734.1.75745 WP_000036734.1.75751 WP_000036734.1.75760 WP_000036734.1.75764 WP_000036734.1.75793 WP_000036734.1.75794 WP_000036734.1.75810 WP_000036734.1.75828 WP_000036734.1.75835 WP_000036734.1.75837 WP_000036734.1.75844 WP_000036734.1.75863 WP_000036734.1.75873 WP_000036734.1.75874 WP_000036734.1.75884 WP_000036734.1.75886 WP_000036734.1.75898 WP_000036734.1.75902 WP_000036734.1.75919 WP_000036734.1.75932 WP_000036734.1.75945 WP_000036734.1.75957 WP_000036734.1.75997 WP_000036734.1.76 WP_000036734.1.76020 WP_000036734.1.76024 WP_000036734.1.76055 WP_000036734.1.76081 WP_000036734.1.76097 WP_000036734.1.76102 WP_000036734.1.76108 WP_000036734.1.76115 WP_000036734.1.76116 WP_000036734.1.76122 WP_000036734.1.76137 WP_000036734.1.76156 WP_000036734.1.76162 WP_000036734.1.76164 WP_000036734.1.76170 WP_000036734.1.76186 WP_000036734.1.76197 WP_000036734.1.76208 WP_000036734.1.76252 WP_000036734.1.76256 WP_000036734.1.7629 WP_000036734.1.76301 WP_000036734.1.76327 WP_000036734.1.7633 WP_000036734.1.76339 WP_000036734.1.7634 WP_000036734.1.76345 WP_000036734.1.76346 WP_000036734.1.76364 WP_000036734.1.76366 WP_000036734.1.76417 WP_000036734.1.76434 WP_000036734.1.76445 WP_000036734.1.76451 WP_000036734.1.7646 WP_000036734.1.76471 WP_000036734.1.76495 WP_000036734.1.76510 WP_000036734.1.76516 WP_000036734.1.76529 WP_000036734.1.76532 WP_000036734.1.76548 WP_000036734.1.7655 WP_000036734.1.76558 WP_000036734.1.7657 WP_000036734.1.76572 WP_000036734.1.76576 WP_000036734.1.7660 WP_000036734.1.76611 WP_000036734.1.76641 WP_000036734.1.76651 WP_000036734.1.76653 WP_000036734.1.76673 WP_000036734.1.76706 WP_000036734.1.7672 WP_000036734.1.76721 WP_000036734.1.76724 WP_000036734.1.76738 WP_000036734.1.76756 WP_000036734.1.76760 WP_000036734.1.76776 WP_000036734.1.76788 WP_000036734.1.76799 WP_000036734.1.76806 WP_000036734.1.7684 WP_000036734.1.76854 WP_000036734.1.76866 WP_000036734.1.76875 WP_000036734.1.76880 WP_000036734.1.76899 WP_000036734.1.76913 WP_000036734.1.76916 WP_000036734.1.76932 WP_000036734.1.76968 WP_000036734.1.76973 WP_000036734.1.76988 WP_000036734.1.77016 WP_000036734.1.77017 WP_000036734.1.77033 WP_000036734.1.77038 WP_000036734.1.77047 WP_000036734.1.77080 WP_000036734.1.77087 WP_000036734.1.77090 WP_000036734.1.77111 WP_000036734.1.7712 WP_000036734.1.77177 WP_000036734.1.77180 WP_000036734.1.77184 WP_000036734.1.77193 WP_000036734.1.77241 WP_000036734.1.77244 WP_000036734.1.77267 WP_000036734.1.77271 WP_000036734.1.77292 WP_000036734.1.77299 WP_000036734.1.77306 WP_000036734.1.77313 WP_000036734.1.77349 WP_000036734.1.77356 WP_000036734.1.77384 WP_000036734.1.77390 WP_000036734.1.77414 WP_000036734.1.77431 WP_000036734.1.77436 WP_000036734.1.77440 WP_000036734.1.77475 WP_000036734.1.77496 WP_000036734.1.77501 WP_000036734.1.77512 WP_000036734.1.77513 WP_000036734.1.77514 WP_000036734.1.77529 WP_000036734.1.77543 WP_000036734.1.77549 WP_000036734.1.77555 WP_000036734.1.77563 WP_000036734.1.77565 WP_000036734.1.77575 WP_000036734.1.77596 WP_000036734.1.77629 WP_000036734.1.77646 WP_000036734.1.77653 WP_000036734.1.77692 WP_000036734.1.77702 WP_000036734.1.77710 WP_000036734.1.77713 WP_000036734.1.7772 WP_000036734.1.77729 WP_000036734.1.77754 WP_000036734.1.77761 WP_000036734.1.7782 WP_000036734.1.77825 WP_000036734.1.77837 WP_000036734.1.7784 WP_000036734.1.77846 WP_000036734.1.77861 WP_000036734.1.77871 WP_000036734.1.77898 WP_000036734.1.77900 WP_000036734.1.77918 WP_000036734.1.7792 WP_000036734.1.77923 WP_000036734.1.7793 WP_000036734.1.77951 WP_000036734.1.77960 WP_000036734.1.77971 WP_000036734.1.77975 WP_000036734.1.77983 WP_000036734.1.77987 WP_000036734.1.77989 WP_000036734.1.78 WP_000036734.1.78016 WP_000036734.1.7802 WP_000036734.1.78026 WP_000036734.1.78035 WP_000036734.1.78048 WP_000036734.1.78051 WP_000036734.1.78053 WP_000036734.1.78076 WP_000036734.1.78096 WP_000036734.1.78100 WP_000036734.1.78107 WP_000036734.1.78110 WP_000036734.1.78120 WP_000036734.1.7814 WP_000036734.1.78166 WP_000036734.1.78168 WP_000036734.1.78170 WP_000036734.1.78180 WP_000036734.1.78192 WP_000036734.1.78195 WP_000036734.1.78201 WP_000036734.1.78245 WP_000036734.1.78259 WP_000036734.1.78291 WP_000036734.1.78301 WP_000036734.1.78309 WP_000036734.1.78320 WP_000036734.1.78339 WP_000036734.1.78366 WP_000036734.1.78372 WP_000036734.1.78382 WP_000036734.1.78383 WP_000036734.1.78388 WP_000036734.1.78407 WP_000036734.1.78410 WP_000036734.1.78426 WP_000036734.1.78443 WP_000036734.1.78495 WP_000036734.1.78496 WP_000036734.1.78501 WP_000036734.1.78502 WP_000036734.1.78568 WP_000036734.1.78602 WP_000036734.1.78603 WP_000036734.1.7861 WP_000036734.1.78618 WP_000036734.1.7862 WP_000036734.1.78626 WP_000036734.1.78632 WP_000036734.1.78658 WP_000036734.1.78661 WP_000036734.1.78673 WP_000036734.1.78674 WP_000036734.1.78676 WP_000036734.1.78697 WP_000036734.1.78715 WP_000036734.1.78734 WP_000036734.1.78735 WP_000036734.1.78738 WP_000036734.1.78761 WP_000036734.1.7877 WP_000036734.1.78771 WP_000036734.1.78789 WP_000036734.1.78802 WP_000036734.1.78815 WP_000036734.1.78830 WP_000036734.1.78835 WP_000036734.1.78838 WP_000036734.1.78862 WP_000036734.1.78871 WP_000036734.1.78874 WP_000036734.1.78877 WP_000036734.1.78881 WP_000036734.1.78896 WP_000036734.1.789 WP_000036734.1.7891 WP_000036734.1.78913 WP_000036734.1.78918 WP_000036734.1.78928 WP_000036734.1.7893 WP_000036734.1.78930 WP_000036734.1.78951 WP_000036734.1.78959 WP_000036734.1.78993 WP_000036734.1.79011 WP_000036734.1.79012 WP_000036734.1.79032 WP_000036734.1.79069 WP_000036734.1.79074 WP_000036734.1.79081 WP_000036734.1.79098 WP_000036734.1.79099 WP_000036734.1.79140 WP_000036734.1.79151 WP_000036734.1.79155 WP_000036734.1.79164 WP_000036734.1.79167 WP_000036734.1.79189 WP_000036734.1.79203 WP_000036734.1.79204 WP_000036734.1.79235 WP_000036734.1.79280 WP_000036734.1.79289 WP_000036734.1.79297 WP_000036734.1.79300 WP_000036734.1.79302 WP_000036734.1.79335 WP_000036734.1.79370 WP_000036734.1.79397 WP_000036734.1.794 WP_000036734.1.79427 WP_000036734.1.79456 WP_000036734.1.79462 WP_000036734.1.79466 WP_000036734.1.79468 WP_000036734.1.79472 WP_000036734.1.79490 WP_000036734.1.79495 WP_000036734.1.79529 WP_000036734.1.79531 WP_000036734.1.79532 WP_000036734.1.79547 WP_000036734.1.7956 WP_000036734.1.79570 WP_000036734.1.79580 WP_000036734.1.79586 WP_000036734.1.7964 WP_000036734.1.79642 WP_000036734.1.79645 WP_000036734.1.79654 WP_000036734.1.79659 WP_000036734.1.79668 WP_000036734.1.7970 WP_000036734.1.79708 WP_000036734.1.7972 WP_000036734.1.79722 WP_000036734.1.79734 WP_000036734.1.79738 WP_000036734.1.79772 WP_000036734.1.79778 WP_000036734.1.7979 WP_000036734.1.7982 WP_000036734.1.79832 WP_000036734.1.79845 WP_000036734.1.79867 WP_000036734.1.79880 WP_000036734.1.79892 WP_000036734.1.7991 WP_000036734.1.79910 WP_000036734.1.79914 WP_000036734.1.79916 WP_000036734.1.79929 WP_000036734.1.79934 WP_000036734.1.7994 WP_000036734.1.79942 WP_000036734.1.79945 WP_000036734.1.79951 WP_000036734.1.79966 WP_000036734.1.79977 WP_000036734.1.79996 WP_000036734.1.80045 WP_000036734.1.80065 WP_000036734.1.80077 WP_000036734.1.80103 WP_000036734.1.80137 WP_000036734.1.80149 WP_000036734.1.80182 WP_000036734.1.80229 WP_000036734.1.80236 WP_000036734.1.8024 WP_000036734.1.80249 WP_000036734.1.80250 WP_000036734.1.80254 WP_000036734.1.80273 WP_000036734.1.80282 WP_000036734.1.80293 WP_000036734.1.80296 WP_000036734.1.80307 WP_000036734.1.80333 WP_000036734.1.80354 WP_000036734.1.80363 WP_000036734.1.80366 WP_000036734.1.80368 WP_000036734.1.80380 WP_000036734.1.80386 WP_000036734.1.80400 WP_000036734.1.80441 WP_000036734.1.80443 WP_000036734.1.80448 WP_000036734.1.80462 WP_000036734.1.80473 WP_000036734.1.80479 WP_000036734.1.80480 WP_000036734.1.8049 WP_000036734.1.80492 WP_000036734.1.80496 WP_000036734.1.80529 WP_000036734.1.80542 WP_000036734.1.80569 WP_000036734.1.80586 WP_000036734.1.80629 WP_000036734.1.80638 WP_000036734.1.80651 WP_000036734.1.80664 WP_000036734.1.80667 WP_000036734.1.80674 WP_000036734.1.80696 WP_000036734.1.80705 WP_000036734.1.80707 WP_000036734.1.80723 WP_000036734.1.80725 WP_000036734.1.80741 WP_000036734.1.80750 WP_000036734.1.80757 WP_000036734.1.80760 WP_000036734.1.80780 WP_000036734.1.80803 WP_000036734.1.80819 WP_000036734.1.80827 WP_000036734.1.80831 WP_000036734.1.80840 WP_000036734.1.80850 WP_000036734.1.80857 WP_000036734.1.80868 WP_000036734.1.80874 WP_000036734.1.80876 WP_000036734.1.80881 WP_000036734.1.80913 WP_000036734.1.80927 WP_000036734.1.80939 WP_000036734.1.80941 WP_000036734.1.80959 WP_000036734.1.8096 WP_000036734.1.80973 WP_000036734.1.80984 WP_000036734.1.81037 WP_000036734.1.81041 WP_000036734.1.8106 WP_000036734.1.81062 WP_000036734.1.81067 WP_000036734.1.81069 WP_000036734.1.81084 WP_000036734.1.81107 WP_000036734.1.81109 WP_000036734.1.81110 WP_000036734.1.81118 WP_000036734.1.81131 WP_000036734.1.81149 WP_000036734.1.81175 WP_000036734.1.81187 WP_000036734.1.8119 WP_000036734.1.81193 WP_000036734.1.81197 WP_000036734.1.81225 WP_000036734.1.81231 WP_000036734.1.81262 WP_000036734.1.81268 WP_000036734.1.81269 WP_000036734.1.81271 WP_000036734.1.81275 WP_000036734.1.8130 WP_000036734.1.81302 WP_000036734.1.81305 WP_000036734.1.8131 WP_000036734.1.81320 WP_000036734.1.81321 WP_000036734.1.81328 WP_000036734.1.81333 WP_000036734.1.8134 WP_000036734.1.81342 WP_000036734.1.81354 WP_000036734.1.81364 WP_000036734.1.81388 WP_000036734.1.81404 WP_000036734.1.81409 WP_000036734.1.81410 WP_000036734.1.81425 WP_000036734.1.81472 WP_000036734.1.81494 WP_000036734.1.81504 WP_000036734.1.81528 WP_000036734.1.81548 WP_000036734.1.81557 WP_000036734.1.81568 WP_000036734.1.81612 WP_000036734.1.81635 WP_000036734.1.81667 WP_000036734.1.81668 WP_000036734.1.81676 WP_000036734.1.8168 WP_000036734.1.81681 WP_000036734.1.8170 WP_000036734.1.81727 WP_000036734.1.81735 WP_000036734.1.81736 WP_000036734.1.81743 WP_000036734.1.81746 WP_000036734.1.81750 WP_000036734.1.81760 WP_000036734.1.81763 WP_000036734.1.81768 WP_000036734.1.81785 WP_000036734.1.81795 WP_000036734.1.81798 WP_000036734.1.81855 WP_000036734.1.81902 WP_000036734.1.81921 WP_000036734.1.81931 WP_000036734.1.81936 WP_000036734.1.81941 WP_000036734.1.81949 WP_000036734.1.8196 WP_000036734.1.81965 WP_000036734.1.81974 WP_000036734.1.81977 WP_000036734.1.81995 WP_000036734.1.82037 WP_000036734.1.82070 WP_000036734.1.82076 WP_000036734.1.82099 WP_000036734.1.82131 WP_000036734.1.82141 WP_000036734.1.82144 WP_000036734.1.82149 WP_000036734.1.82156 WP_000036734.1.8218 WP_000036734.1.82180 WP_000036734.1.82192 WP_000036734.1.82201 WP_000036734.1.82214 WP_000036734.1.82225 WP_000036734.1.82232 WP_000036734.1.82258 WP_000036734.1.82269 WP_000036734.1.82337 WP_000036734.1.82347 WP_000036734.1.82352 WP_000036734.1.8236 WP_000036734.1.82369 WP_000036734.1.82395 WP_000036734.1.8240 WP_000036734.1.82401 WP_000036734.1.82408 WP_000036734.1.82416 WP_000036734.1.8242 WP_000036734.1.82420 WP_000036734.1.82434 WP_000036734.1.82456 WP_000036734.1.82464 WP_000036734.1.82465 WP_000036734.1.8247 WP_000036734.1.82473 WP_000036734.1.82474 WP_000036734.1.82479 WP_000036734.1.82503 WP_000036734.1.82515 WP_000036734.1.82529 WP_000036734.1.82530 WP_000036734.1.82553 WP_000036734.1.82562 WP_000036734.1.82569 WP_000036734.1.82570 WP_000036734.1.82584 WP_000036734.1.82636 WP_000036734.1.82637 WP_000036734.1.82646 WP_000036734.1.82648 WP_000036734.1.82670 WP_000036734.1.82676 WP_000036734.1.82692 WP_000036734.1.82731 WP_000036734.1.82761 WP_000036734.1.82763 WP_000036734.1.82812 WP_000036734.1.8282 WP_000036734.1.82841 WP_000036734.1.82843 WP_000036734.1.82850 WP_000036734.1.82865 WP_000036734.1.82867 WP_000036734.1.82872 WP_000036734.1.82886 WP_000036734.1.82895 WP_000036734.1.82899 WP_000036734.1.82908 WP_000036734.1.82937 WP_000036734.1.8294 WP_000036734.1.82944 WP_000036734.1.82946 WP_000036734.1.82956 WP_000036734.1.82959 WP_000036734.1.82964 WP_000036734.1.82992 WP_000036734.1.83005 WP_000036734.1.83006 WP_000036734.1.83007 WP_000036734.1.8304 WP_000036734.1.83061 WP_000036734.1.83092 WP_000036734.1.83119 WP_000036734.1.83128 WP_000036734.1.83139 WP_000036734.1.83163 WP_000036734.1.83180 WP_000036734.1.83204 WP_000036734.1.8322 WP_000036734.1.83221 WP_000036734.1.83229 WP_000036734.1.83235 WP_000036734.1.83247 WP_000036734.1.83252 WP_000036734.1.83258 WP_000036734.1.83280 WP_000036734.1.83290 WP_000036734.1.83301 WP_000036734.1.83305 WP_000036734.1.83331 WP_000036734.1.83333 WP_000036734.1.83354 WP_000036734.1.83356 WP_000036734.1.83360 WP_000036734.1.83365 WP_000036734.1.83378 WP_000036734.1.83382 WP_000036734.1.83388 WP_000036734.1.83407 WP_000036734.1.83491 WP_000036734.1.83510 WP_000036734.1.83516 WP_000036734.1.83523 WP_000036734.1.8354 WP_000036734.1.83558 WP_000036734.1.83572 WP_000036734.1.83598 WP_000036734.1.83632 WP_000036734.1.83650 WP_000036734.1.83651 WP_000036734.1.83657 WP_000036734.1.83677 WP_000036734.1.83710 WP_000036734.1.83721 WP_000036734.1.83739 WP_000036734.1.8375 WP_000036734.1.83759 WP_000036734.1.83760 WP_000036734.1.83806 WP_000036734.1.83838 WP_000036734.1.83854 WP_000036734.1.83897 WP_000036734.1.83923 WP_000036734.1.83960 WP_000036734.1.83979 WP_000036734.1.8399 WP_000036734.1.83994 WP_000036734.1.83995 WP_000036734.1.84 WP_000036734.1.84000 WP_000036734.1.84001 WP_000036734.1.84011 WP_000036734.1.84031 WP_000036734.1.8406 WP_000036734.1.84075 WP_000036734.1.84076 WP_000036734.1.84077 WP_000036734.1.84083 WP_000036734.1.84086 WP_000036734.1.84100 WP_000036734.1.84103 WP_000036734.1.84106 WP_000036734.1.84110 WP_000036734.1.84115 WP_000036734.1.84127 WP_000036734.1.84150 WP_000036734.1.84154 WP_000036734.1.84168 WP_000036734.1.84179 WP_000036734.1.84198 WP_000036734.1.84205 WP_000036734.1.84209 WP_000036734.1.84229 WP_000036734.1.84230 WP_000036734.1.84252 WP_000036734.1.84283 WP_000036734.1.84291 WP_000036734.1.84300 WP_000036734.1.8431 WP_000036734.1.84325 WP_000036734.1.84345 WP_000036734.1.84355 WP_000036734.1.84359 WP_000036734.1.84369 WP_000036734.1.84373 WP_000036734.1.84392 WP_000036734.1.84397 WP_000036734.1.84401 WP_000036734.1.84403 WP_000036734.1.8441 WP_000036734.1.84435 WP_000036734.1.84459 WP_000036734.1.84461 WP_000036734.1.84475 WP_000036734.1.84497 WP_000036734.1.84515 WP_000036734.1.84523 WP_000036734.1.84532 WP_000036734.1.84551 WP_000036734.1.84567 WP_000036734.1.84572 WP_000036734.1.84598 WP_000036734.1.84631 WP_000036734.1.84644 WP_000036734.1.84659 WP_000036734.1.84683 WP_000036734.1.84693 WP_000036734.1.84711 WP_000036734.1.84721 WP_000036734.1.84727 WP_000036734.1.84744 WP_000036734.1.84745 WP_000036734.1.84773 WP_000036734.1.84814 WP_000036734.1.84860 WP_000036734.1.84872 WP_000036734.1.84876 WP_000036734.1.84879 WP_000036734.1.84885 WP_000036734.1.84899 WP_000036734.1.849 WP_000036734.1.84945 WP_000036734.1.84967 WP_000036734.1.8497 WP_000036734.1.84983 WP_000036734.1.850 WP_000036734.1.85004 WP_000036734.1.85014 WP_000036734.1.8502 WP_000036734.1.85031 WP_000036734.1.85039 WP_000036734.1.85040 WP_000036734.1.85079 WP_000036734.1.85094 WP_000036734.1.85120 WP_000036734.1.85126 WP_000036734.1.85134 WP_000036734.1.85147 WP_000036734.1.85153 WP_000036734.1.85178 WP_000036734.1.85180 WP_000036734.1.85190 WP_000036734.1.85192 WP_000036734.1.85217 WP_000036734.1.8526 WP_000036734.1.85271 WP_000036734.1.85273 WP_000036734.1.85301 WP_000036734.1.8533 WP_000036734.1.85338 WP_000036734.1.85339 WP_000036734.1.8537 WP_000036734.1.85408 WP_000036734.1.85433 WP_000036734.1.85456 WP_000036734.1.85469 WP_000036734.1.85481 WP_000036734.1.85483 WP_000036734.1.85511 WP_000036734.1.85512 WP_000036734.1.8552 WP_000036734.1.85541 WP_000036734.1.8556 WP_000036734.1.85568 WP_000036734.1.8557 WP_000036734.1.85606 WP_000036734.1.85615 WP_000036734.1.85617 WP_000036734.1.85635 WP_000036734.1.85646 WP_000036734.1.85654 WP_000036734.1.85663 WP_000036734.1.85665 WP_000036734.1.85669 WP_000036734.1.85671 WP_000036734.1.85672 WP_000036734.1.85675 WP_000036734.1.85688 WP_000036734.1.85703 WP_000036734.1.85723 WP_000036734.1.85728 WP_000036734.1.85742 WP_000036734.1.85746 WP_000036734.1.85759 WP_000036734.1.85780 WP_000036734.1.85784 WP_000036734.1.85791 WP_000036734.1.85797 WP_000036734.1.85811 WP_000036734.1.85854 WP_000036734.1.85855 WP_000036734.1.85864 WP_000036734.1.85886 WP_000036734.1.859 WP_000036734.1.85900 WP_000036734.1.85904 WP_000036734.1.8591 WP_000036734.1.85917 WP_000036734.1.8594 WP_000036734.1.85943 WP_000036734.1.85976 WP_000036734.1.85977 WP_000036734.1.85982 WP_000036734.1.860 WP_000036734.1.86007 WP_000036734.1.86017 WP_000036734.1.86043 WP_000036734.1.8605 WP_000036734.1.86084 WP_000036734.1.86092 WP_000036734.1.8610 WP_000036734.1.86120 WP_000036734.1.86126 WP_000036734.1.86138 WP_000036734.1.8614 WP_000036734.1.86156 WP_000036734.1.86157 WP_000036734.1.8616 WP_000036734.1.86173 WP_000036734.1.86206 WP_000036734.1.86224 WP_000036734.1.86259 WP_000036734.1.86284 WP_000036734.1.86285 WP_000036734.1.86306 WP_000036734.1.86310 WP_000036734.1.86316 WP_000036734.1.86323 WP_000036734.1.86335 WP_000036734.1.86342 WP_000036734.1.86347 WP_000036734.1.86356 WP_000036734.1.86380 WP_000036734.1.86389 WP_000036734.1.8640 WP_000036734.1.8642 WP_000036734.1.86426 WP_000036734.1.86442 WP_000036734.1.86450 WP_000036734.1.86453 WP_000036734.1.86466 WP_000036734.1.86469 WP_000036734.1.8647 WP_000036734.1.86489 WP_000036734.1.86514 WP_000036734.1.86530 WP_000036734.1.86580 WP_000036734.1.86588 WP_000036734.1.86593 WP_000036734.1.86610 WP_000036734.1.86634 WP_000036734.1.86656 WP_000036734.1.86658 WP_000036734.1.86661 WP_000036734.1.86663 WP_000036734.1.86676 WP_000036734.1.86699 WP_000036734.1.8671 WP_000036734.1.8672 WP_000036734.1.86735 WP_000036734.1.86744 WP_000036734.1.86769 WP_000036734.1.86770 WP_000036734.1.8678 WP_000036734.1.86794 WP_000036734.1.86800 WP_000036734.1.86807 WP_000036734.1.86810 WP_000036734.1.86811 WP_000036734.1.86815 WP_000036734.1.8684 WP_000036734.1.86859 WP_000036734.1.86860 WP_000036734.1.86895 WP_000036734.1.86902 WP_000036734.1.86906 WP_000036734.1.8691 WP_000036734.1.86915 WP_000036734.1.86921 WP_000036734.1.86945 WP_000036734.1.86982 WP_000036734.1.86989 WP_000036734.1.87023 WP_000036734.1.87034 WP_000036734.1.87038 WP_000036734.1.87041 WP_000036734.1.87051 WP_000036734.1.87095 WP_000036734.1.87136 WP_000036734.1.87143 WP_000036734.1.87148 WP_000036734.1.87155 WP_000036734.1.87219 WP_000036734.1.8722 WP_000036734.1.87220 WP_000036734.1.87258 WP_000036734.1.87265 WP_000036734.1.87276 WP_000036734.1.87282 WP_000036734.1.87283 WP_000036734.1.87293 WP_000036734.1.87323 WP_000036734.1.87346 WP_000036734.1.8736 WP_000036734.1.87365 WP_000036734.1.87370 WP_000036734.1.87376 WP_000036734.1.87420 WP_000036734.1.87460 WP_000036734.1.87484 WP_000036734.1.87493 WP_000036734.1.87500 WP_000036734.1.87528 WP_000036734.1.87552 WP_000036734.1.87560 WP_000036734.1.87583 WP_000036734.1.87584 WP_000036734.1.8760 WP_000036734.1.87600 WP_000036734.1.87609 WP_000036734.1.87612 WP_000036734.1.87615 WP_000036734.1.87618 WP_000036734.1.87626 WP_000036734.1.87651 WP_000036734.1.87653 WP_000036734.1.87659 WP_000036734.1.8767 WP_000036734.1.87687 WP_000036734.1.87695 WP_000036734.1.87698 WP_000036734.1.87706 WP_000036734.1.87712 WP_000036734.1.87739 WP_000036734.1.87741 WP_000036734.1.87742 WP_000036734.1.87779 WP_000036734.1.87813 WP_000036734.1.87852 WP_000036734.1.87875 WP_000036734.1.87891 WP_000036734.1.87899 WP_000036734.1.87905 WP_000036734.1.8792 WP_000036734.1.87933 WP_000036734.1.87945 WP_000036734.1.87949 WP_000036734.1.87999 WP_000036734.1.8800 WP_000036734.1.88014 WP_000036734.1.88019 WP_000036734.1.88025 WP_000036734.1.88026 WP_000036734.1.8805 WP_000036734.1.88052 WP_000036734.1.8806 WP_000036734.1.88073 WP_000036734.1.8809 WP_000036734.1.88092 WP_000036734.1.881 WP_000036734.1.88145 WP_000036734.1.88165 WP_000036734.1.88174 WP_000036734.1.88185 WP_000036734.1.88199 WP_000036734.1.88214 WP_000036734.1.88222 WP_000036734.1.88244 WP_000036734.1.88264 WP_000036734.1.88275 WP_000036734.1.88291 WP_000036734.1.88293 WP_000036734.1.88299 WP_000036734.1.88303 WP_000036734.1.88313 WP_000036734.1.88356 WP_000036734.1.88359 WP_000036734.1.8837 WP_000036734.1.88393 WP_000036734.1.88407 WP_000036734.1.88414 WP_000036734.1.88423 WP_000036734.1.88444 WP_000036734.1.88446 WP_000036734.1.88458 WP_000036734.1.88474 WP_000036734.1.88483 WP_000036734.1.8849 WP_000036734.1.88501 WP_000036734.1.88508 WP_000036734.1.88538 WP_000036734.1.88547 WP_000036734.1.88597 WP_000036734.1.886 WP_000036734.1.88609 WP_000036734.1.88620 WP_000036734.1.88624 WP_000036734.1.88647 WP_000036734.1.88648 WP_000036734.1.88651 WP_000036734.1.88675 WP_000036734.1.88683 WP_000036734.1.88692 WP_000036734.1.88698 WP_000036734.1.88703 WP_000036734.1.88707 WP_000036734.1.88727 WP_000036734.1.88731 WP_000036734.1.88772 WP_000036734.1.88776 WP_000036734.1.88792 WP_000036734.1.88817 WP_000036734.1.88845 WP_000036734.1.88850 WP_000036734.1.88854 WP_000036734.1.8889 WP_000036734.1.88892 WP_000036734.1.88894 WP_000036734.1.88902 WP_000036734.1.8891 WP_000036734.1.88942 WP_000036734.1.88957 WP_000036734.1.88966 WP_000036734.1.88967 WP_000036734.1.88968 WP_000036734.1.88970 WP_000036734.1.88980 WP_000036734.1.88995 WP_000036734.1.88998 WP_000036734.1.89008 WP_000036734.1.89054 WP_000036734.1.89114 WP_000036734.1.89116 WP_000036734.1.89119 WP_000036734.1.89120 WP_000036734.1.89138 WP_000036734.1.89169 WP_000036734.1.89174 WP_000036734.1.89177 WP_000036734.1.89182 WP_000036734.1.89188 WP_000036734.1.89215 WP_000036734.1.89221 WP_000036734.1.89291 WP_000036734.1.89298 WP_000036734.1.89304 WP_000036734.1.89308 WP_000036734.1.89311 WP_000036734.1.89314 WP_000036734.1.89328 WP_000036734.1.89332 WP_000036734.1.89343 WP_000036734.1.89354 WP_000036734.1.89355 WP_000036734.1.89362 WP_000036734.1.89395 WP_000036734.1.8940 WP_000036734.1.89408 WP_000036734.1.89425 WP_000036734.1.89449 WP_000036734.1.89452 WP_000036734.1.89462 WP_000036734.1.8947 WP_000036734.1.89503 WP_000036734.1.89512 WP_000036734.1.89527 WP_000036734.1.89570 WP_000036734.1.8958 WP_000036734.1.89580 WP_000036734.1.89591 WP_000036734.1.89604 WP_000036734.1.89606 WP_000036734.1.8961 WP_000036734.1.89612 WP_000036734.1.89622 WP_000036734.1.89632 WP_000036734.1.89634 WP_000036734.1.89636 WP_000036734.1.89647 WP_000036734.1.89657 WP_000036734.1.89659 WP_000036734.1.89668 WP_000036734.1.89680 WP_000036734.1.89706 WP_000036734.1.89713 WP_000036734.1.89733 WP_000036734.1.89746 WP_000036734.1.89764 WP_000036734.1.89765 WP_000036734.1.89777 WP_000036734.1.89789 WP_000036734.1.89796 WP_000036734.1.89804 WP_000036734.1.89815 WP_000036734.1.89817 WP_000036734.1.89832 WP_000036734.1.89845 WP_000036734.1.89854 WP_000036734.1.89870 WP_000036734.1.89888 WP_000036734.1.89902 WP_000036734.1.89911 WP_000036734.1.89914 WP_000036734.1.89940 WP_000036734.1.8995 WP_000036734.1.89952 WP_000036734.1.8996 WP_000036734.1.89965 WP_000036734.1.89975 WP_000036734.1.90007 WP_000036734.1.9002 WP_000036734.1.9003 WP_000036734.1.90033 WP_000036734.1.90084 WP_000036734.1.90097 WP_000036734.1.90108 WP_000036734.1.9011 WP_000036734.1.90196 WP_000036734.1.90211 WP_000036734.1.90220 WP_000036734.1.90240 WP_000036734.1.90252 WP_000036734.1.90274 WP_000036734.1.90280 WP_000036734.1.90293 WP_000036734.1.90302 WP_000036734.1.90311 WP_000036734.1.90330 WP_000036734.1.90338 WP_000036734.1.90348 WP_000036734.1.90363 WP_000036734.1.90365 WP_000036734.1.90409 WP_000036734.1.90417 WP_000036734.1.90421 WP_000036734.1.90428 WP_000036734.1.90440 WP_000036734.1.90453 WP_000036734.1.90458 WP_000036734.1.90472 WP_000036734.1.90489 WP_000036734.1.90513 WP_000036734.1.90521 WP_000036734.1.90522 WP_000036734.1.90540 WP_000036734.1.90557 WP_000036734.1.90563 WP_000036734.1.90566 WP_000036734.1.90582 WP_000036734.1.90585 WP_000036734.1.90617 WP_000036734.1.90620 WP_000036734.1.90625 WP_000036734.1.9064 WP_000036734.1.90641 WP_000036734.1.90686 WP_000036734.1.90701 WP_000036734.1.90713 WP_000036734.1.90734 WP_000036734.1.90748 WP_000036734.1.90752 WP_000036734.1.90759 WP_000036734.1.90792 WP_000036734.1.90794 WP_000036734.1.90796 WP_000036734.1.90811 WP_000036734.1.90814 WP_000036734.1.90859 WP_000036734.1.90866 WP_000036734.1.90876 WP_000036734.1.90878 WP_000036734.1.9089 WP_000036734.1.9091 WP_000036734.1.9093 WP_000036734.1.90959 WP_000036734.1.90973 WP_000036734.1.90983 WP_000036734.1.90984 WP_000036734.1.90991 WP_000036734.1.91003 WP_000036734.1.91023 WP_000036734.1.91042 WP_000036734.1.91049 WP_000036734.1.91056 WP_000036734.1.91067 WP_000036734.1.91069 WP_000036734.1.91107 WP_000036734.1.91156 WP_000036734.1.91164 WP_000036734.1.91179 WP_000036734.1.91189 WP_000036734.1.91205 WP_000036734.1.91215 WP_000036734.1.91239 WP_000036734.1.91278 WP_000036734.1.91282 WP_000036734.1.91291 WP_000036734.1.9131 WP_000036734.1.91312 WP_000036734.1.91313 WP_000036734.1.91331 WP_000036734.1.91334 WP_000036734.1.9135 WP_000036734.1.9137 WP_000036734.1.91372 WP_000036734.1.91381 WP_000036734.1.91405 WP_000036734.1.91424 WP_000036734.1.91453 WP_000036734.1.91459 WP_000036734.1.91470 WP_000036734.1.91473 WP_000036734.1.91474 WP_000036734.1.91493 WP_000036734.1.91505 WP_000036734.1.91506 WP_000036734.1.91512 WP_000036734.1.91524 WP_000036734.1.91528 WP_000036734.1.91557 WP_000036734.1.91564 WP_000036734.1.91579 WP_000036734.1.91580 WP_000036734.1.91597 WP_000036734.1.91621 WP_000036734.1.91625 WP_000036734.1.91628 WP_000036734.1.91655 WP_000036734.1.9166 WP_000036734.1.91702 WP_000036734.1.91715 WP_000036734.1.91724 WP_000036734.1.91732 WP_000036734.1.91736 WP_000036734.1.91742 WP_000036734.1.91772 WP_000036734.1.91776 WP_000036734.1.91788 WP_000036734.1.91795 WP_000036734.1.91806 WP_000036734.1.91864 WP_000036734.1.9187 WP_000036734.1.91870 WP_000036734.1.91880 WP_000036734.1.91898 WP_000036734.1.91903 WP_000036734.1.91904 WP_000036734.1.91914 WP_000036734.1.91974 WP_000036734.1.91984 WP_000036734.1.92013 WP_000036734.1.92018 WP_000036734.1.92039 WP_000036734.1.92044 WP_000036734.1.92047 WP_000036734.1.92060 WP_000036734.1.92067 WP_000036734.1.92068 WP_000036734.1.92082 WP_000036734.1.92087 WP_000036734.1.92093 WP_000036734.1.92098 WP_000036734.1.92099 WP_000036734.1.92108 WP_000036734.1.92122 WP_000036734.1.92129 WP_000036734.1.92149 WP_000036734.1.92156 WP_000036734.1.92165 WP_000036734.1.92171 WP_000036734.1.92172 WP_000036734.1.92183 WP_000036734.1.92208 WP_000036734.1.92213 WP_000036734.1.9222 WP_000036734.1.92240 WP_000036734.1.92243 WP_000036734.1.92268 WP_000036734.1.92270 WP_000036734.1.92299 WP_000036734.1.92310 WP_000036734.1.92318 WP_000036734.1.92327 WP_000036734.1.92375 WP_000036734.1.92394 WP_000036734.1.92396 WP_000036734.1.92399 WP_000036734.1.92408 WP_000036734.1.92411 WP_000036734.1.92439 WP_000036734.1.92443 WP_000036734.1.92452 WP_000036734.1.92470 WP_000036734.1.92477 WP_000036734.1.92482 WP_000036734.1.92529 WP_000036734.1.9253 WP_000036734.1.92531 WP_000036734.1.92545 WP_000036734.1.92557 WP_000036734.1.92562 WP_000036734.1.92570 WP_000036734.1.92575 WP_000036734.1.92588 WP_000036734.1.926 WP_000036734.1.92628 WP_000036734.1.92633 WP_000036734.1.92646 WP_000036734.1.92649 WP_000036734.1.92659 WP_000036734.1.92669 WP_000036734.1.92671 WP_000036734.1.92676 WP_000036734.1.92705 WP_000036734.1.9271 WP_000036734.1.92729 WP_000036734.1.92734 WP_000036734.1.92738 WP_000036734.1.92758 WP_000036734.1.9276 WP_000036734.1.92786 WP_000036734.1.92806 WP_000036734.1.92810 WP_000036734.1.92823 WP_000036734.1.92827 WP_000036734.1.92832 WP_000036734.1.92836 WP_000036734.1.92842 WP_000036734.1.92843 WP_000036734.1.92875 WP_000036734.1.92879 WP_000036734.1.92883 WP_000036734.1.92890 WP_000036734.1.92893 WP_000036734.1.92895 WP_000036734.1.92926 WP_000036734.1.92929 WP_000036734.1.92936 WP_000036734.1.92939 WP_000036734.1.92947 WP_000036734.1.92975 WP_000036734.1.92987 WP_000036734.1.92988 WP_000036734.1.93007 WP_000036734.1.93022 WP_000036734.1.93059 WP_000036734.1.93061 WP_000036734.1.93076 WP_000036734.1.93086 WP_000036734.1.93101 WP_000036734.1.93103 WP_000036734.1.93105 WP_000036734.1.93111 WP_000036734.1.93118 WP_000036734.1.93121 WP_000036734.1.93136 WP_000036734.1.93155 WP_000036734.1.93168 WP_000036734.1.93184 WP_000036734.1.93213 WP_000036734.1.93215 WP_000036734.1.93221 WP_000036734.1.93223 WP_000036734.1.93239 WP_000036734.1.93275 WP_000036734.1.93302 WP_000036734.1.93322 WP_000036734.1.93339 WP_000036734.1.93350 WP_000036734.1.9336 WP_000036734.1.93365 WP_000036734.1.93376 WP_000036734.1.93387 WP_000036734.1.93469 WP_000036734.1.93511 WP_000036734.1.93512 WP_000036734.1.93524 WP_000036734.1.93543 WP_000036734.1.93577 WP_000036734.1.93596 WP_000036734.1.93604 WP_000036734.1.93635 WP_000036734.1.93648 WP_000036734.1.93650 WP_000036734.1.93656 WP_000036734.1.93657 WP_000036734.1.93662 WP_000036734.1.93671 WP_000036734.1.93691 WP_000036734.1.937 WP_000036734.1.93705 WP_000036734.1.9374 WP_000036734.1.93741 WP_000036734.1.9375 WP_000036734.1.93754 WP_000036734.1.93761 WP_000036734.1.93767 WP_000036734.1.93780 WP_000036734.1.9380 WP_000036734.1.93803 WP_000036734.1.93804 WP_000036734.1.93809 WP_000036734.1.93828 WP_000036734.1.93837 WP_000036734.1.93842 WP_000036734.1.93843 WP_000036734.1.93875 WP_000036734.1.9389 WP_000036734.1.93909 WP_000036734.1.93919 WP_000036734.1.93937 WP_000036734.1.93938 WP_000036734.1.9394 WP_000036734.1.93956 WP_000036734.1.93984 WP_000036734.1.93986 WP_000036734.1.9399 WP_000036734.1.93994 WP_000036734.1.94017 WP_000036734.1.94039 WP_000036734.1.94056 WP_000036734.1.94064 WP_000036734.1.94070 WP_000036734.1.94071 WP_000036734.1.94072 WP_000036734.1.94079 WP_000036734.1.94097 WP_000036734.1.94107 WP_000036734.1.94132 WP_000036734.1.94142 WP_000036734.1.94167 WP_000036734.1.94168 WP_000036734.1.94181 WP_000036734.1.94198 WP_000036734.1.94215 WP_000036734.1.94303 WP_000036734.1.9432 WP_000036734.1.94352 WP_000036734.1.94354 WP_000036734.1.94365 WP_000036734.1.94379 WP_000036734.1.94380 WP_000036734.1.94383 WP_000036734.1.94390 WP_000036734.1.9440 WP_000036734.1.94412 WP_000036734.1.94415 WP_000036734.1.94458 WP_000036734.1.94461 WP_000036734.1.94473 WP_000036734.1.94492 WP_000036734.1.94510 WP_000036734.1.94527 WP_000036734.1.94557 WP_000036734.1.94562 WP_000036734.1.94565 WP_000036734.1.94573 WP_000036734.1.94579 WP_000036734.1.94584 WP_000036734.1.94586 WP_000036734.1.94588 WP_000036734.1.94593 WP_000036734.1.94598 WP_000036734.1.94622 WP_000036734.1.9463 WP_000036734.1.94649 WP_000036734.1.94650 WP_000036734.1.94655 WP_000036734.1.94659 WP_000036734.1.94662 WP_000036734.1.94669 WP_000036734.1.94670 WP_000036734.1.94674 WP_000036734.1.94700 WP_000036734.1.94717 WP_000036734.1.94722 WP_000036734.1.94745 WP_000036734.1.94782 WP_000036734.1.94785 WP_000036734.1.94796 WP_000036734.1.94798 WP_000036734.1.9481 WP_000036734.1.94815 WP_000036734.1.94817 WP_000036734.1.94820 WP_000036734.1.94835 WP_000036734.1.94849 WP_000036734.1.94850 WP_000036734.1.94851 WP_000036734.1.94862 WP_000036734.1.94864 WP_000036734.1.94947 WP_000036734.1.94952 WP_000036734.1.94959 WP_000036734.1.94967 WP_000036734.1.94971 WP_000036734.1.94982 WP_000036734.1.94986 WP_000036734.1.94987 WP_000036734.1.95006 WP_000036734.1.9503 WP_000036734.1.95051 WP_000036734.1.95055 WP_000036734.1.95076 WP_000036734.1.95085 WP_000036734.1.95094 WP_000036734.1.95099 WP_000036734.1.95121 WP_000036734.1.95133 WP_000036734.1.95136 WP_000036734.1.95152 WP_000036734.1.9516 WP_000036734.1.95165 WP_000036734.1.95171 WP_000036734.1.95235 WP_000036734.1.95239 WP_000036734.1.95246 WP_000036734.1.95248 WP_000036734.1.95249 WP_000036734.1.9525 WP_000036734.1.95255 WP_000036734.1.95265 WP_000036734.1.9527 WP_000036734.1.95277 WP_000036734.1.95282 WP_000036734.1.95289 WP_000036734.1.95298 WP_000036734.1.9530 WP_000036734.1.95320 WP_000036734.1.95338 WP_000036734.1.95388 WP_000036734.1.95404 WP_000036734.1.95412 WP_000036734.1.95434 WP_000036734.1.95447 WP_000036734.1.95456 WP_000036734.1.95465 WP_000036734.1.95530 WP_000036734.1.95546 WP_000036734.1.95547 WP_000036734.1.95579 WP_000036734.1.95590 WP_000036734.1.95607 WP_000036734.1.95623 WP_000036734.1.95625 WP_000036734.1.95630 WP_000036734.1.95641 WP_000036734.1.95656 WP_000036734.1.95670 WP_000036734.1.95675 WP_000036734.1.95691 WP_000036734.1.95701 WP_000036734.1.95703 WP_000036734.1.95716 WP_000036734.1.95729 WP_000036734.1.9574 WP_000036734.1.95744 WP_000036734.1.95757 WP_000036734.1.95776 WP_000036734.1.95803 WP_000036734.1.95805 WP_000036734.1.95826 WP_000036734.1.95840 WP_000036734.1.9586 WP_000036734.1.95866 WP_000036734.1.95884 WP_000036734.1.95890 WP_000036734.1.95901 WP_000036734.1.95906 WP_000036734.1.95911 WP_000036734.1.95939 WP_000036734.1.95940 WP_000036734.1.95963 WP_000036734.1.96004 WP_000036734.1.96025 WP_000036734.1.96042 WP_000036734.1.96044 WP_000036734.1.96045 WP_000036734.1.96054 WP_000036734.1.9609 WP_000036734.1.96094 WP_000036734.1.96107 WP_000036734.1.96127 WP_000036734.1.96141 WP_000036734.1.96144 WP_000036734.1.96162 WP_000036734.1.96172 WP_000036734.1.96188 WP_000036734.1.96190 WP_000036734.1.96203 WP_000036734.1.96206 WP_000036734.1.96211 WP_000036734.1.96212 WP_000036734.1.9624 WP_000036734.1.96260 WP_000036734.1.9627 WP_000036734.1.9628 WP_000036734.1.96317 WP_000036734.1.96319 WP_000036734.1.9633 WP_000036734.1.96335 WP_000036734.1.96340 WP_000036734.1.96343 WP_000036734.1.96348 WP_000036734.1.96349 WP_000036734.1.96359 WP_000036734.1.96380 WP_000036734.1.96404 WP_000036734.1.96429 WP_000036734.1.9644 WP_000036734.1.96469 WP_000036734.1.96497 WP_000036734.1.96500 WP_000036734.1.96521 WP_000036734.1.96533 WP_000036734.1.96537 WP_000036734.1.96539 WP_000036734.1.96552 WP_000036734.1.96555 WP_000036734.1.96563 WP_000036734.1.96588 WP_000036734.1.96590 WP_000036734.1.96600 WP_000036734.1.96610 WP_000036734.1.96625 WP_000036734.1.96635 WP_000036734.1.9664 WP_000036734.1.96640 WP_000036734.1.96642 WP_000036734.1.96662 WP_000036734.1.96675 WP_000036734.1.9670 WP_000036734.1.96721 WP_000036734.1.96731 WP_000036734.1.96732 WP_000036734.1.96735 WP_000036734.1.9674 WP_000036734.1.96750 WP_000036734.1.96758 WP_000036734.1.96761 WP_000036734.1.96771 WP_000036734.1.96792 WP_000036734.1.96798 WP_000036734.1.96801 WP_000036734.1.96803 WP_000036734.1.96810 WP_000036734.1.9686 WP_000036734.1.96876 WP_000036734.1.96890 WP_000036734.1.96902 WP_000036734.1.96917 WP_000036734.1.96925 WP_000036734.1.96938 WP_000036734.1.96946 WP_000036734.1.96957 WP_000036734.1.96978 WP_000036734.1.96993 WP_000036734.1.97005 WP_000036734.1.97015 WP_000036734.1.97026 WP_000036734.1.97028 WP_000036734.1.97043 WP_000036734.1.97047 WP_000036734.1.97079 WP_000036734.1.97089 WP_000036734.1.97103 WP_000036734.1.97109 WP_000036734.1.97143 WP_000036734.1.97145 WP_000036734.1.97154 WP_000036734.1.97184 WP_000036734.1.97185 WP_000036734.1.97190 WP_000036734.1.97224 WP_000036734.1.97260 WP_000036734.1.97287 WP_000036734.1.97291 WP_000036734.1.97297 WP_000036734.1.97318 WP_000036734.1.97322 WP_000036734.1.97328 WP_000036734.1.97337 WP_000036734.1.97368 WP_000036734.1.97369 WP_000036734.1.97386 WP_000036734.1.97413 WP_000036734.1.97422 WP_000036734.1.97441 WP_000036734.1.97477 WP_000036734.1.97480 WP_000036734.1.97487 WP_000036734.1.97496 WP_000036734.1.97497 WP_000036734.1.97505 WP_000036734.1.97534 WP_000036734.1.97547 WP_000036734.1.97594 WP_000036734.1.97597 WP_000036734.1.97599 WP_000036734.1.97604 WP_000036734.1.97606 WP_000036734.1.97613 WP_000036734.1.97615 WP_000036734.1.97620 WP_000036734.1.97626 WP_000036734.1.97628 WP_000036734.1.97631 WP_000036734.1.97640 WP_000036734.1.97646 WP_000036734.1.97648 WP_000036734.1.97656 WP_000036734.1.97690 WP_000036734.1.97691 WP_000036734.1.97693 WP_000036734.1.97704 WP_000036734.1.97725 WP_000036734.1.97726 WP_000036734.1.97727 WP_000036734.1.97732 WP_000036734.1.97736 WP_000036734.1.9774 WP_000036734.1.9775 WP_000036734.1.97768 WP_000036734.1.97772 WP_000036734.1.97800 WP_000036734.1.97819 WP_000036734.1.97840 WP_000036734.1.97846 WP_000036734.1.97873 WP_000036734.1.97907 WP_000036734.1.9793 WP_000036734.1.97938 WP_000036734.1.97981 WP_000036734.1.97983 WP_000036734.1.97986 WP_000036734.1.9799 WP_000036734.1.97991 WP_000036734.1.98006 WP_000036734.1.98019 WP_000036734.1.98022 WP_000036734.1.98036 WP_000036734.1.9805 WP_000036734.1.98080 WP_000036734.1.98086 WP_000036734.1.98107 WP_000036734.1.9811 WP_000036734.1.98110 WP_000036734.1.98119 WP_000036734.1.98124 WP_000036734.1.98146 WP_000036734.1.98158 WP_000036734.1.98170 WP_000036734.1.98201 WP_000036734.1.98219 WP_000036734.1.98236 WP_000036734.1.98250 WP_000036734.1.9826 WP_000036734.1.98263 WP_000036734.1.98266 WP_000036734.1.98314 WP_000036734.1.98338 WP_000036734.1.98392 WP_000036734.1.98402 WP_000036734.1.98403 WP_000036734.1.9841 WP_000036734.1.98418 WP_000036734.1.98438 WP_000036734.1.98440 WP_000036734.1.98446 WP_000036734.1.98448 WP_000036734.1.98457 WP_000036734.1.98472 WP_000036734.1.98483 WP_000036734.1.98495 WP_000036734.1.9850 WP_000036734.1.98502 WP_000036734.1.98513 WP_000036734.1.98531 WP_000036734.1.98551 WP_000036734.1.98558 WP_000036734.1.98570 WP_000036734.1.98577 WP_000036734.1.98607 WP_000036734.1.98608 WP_000036734.1.98627 WP_000036734.1.9863 WP_000036734.1.98634 WP_000036734.1.98676 WP_000036734.1.98677 WP_000036734.1.98726 WP_000036734.1.98731 WP_000036734.1.98751 WP_000036734.1.98760 WP_000036734.1.98762 WP_000036734.1.98763 WP_000036734.1.9877 WP_000036734.1.98779 WP_000036734.1.98801 WP_000036734.1.98818 WP_000036734.1.98843 WP_000036734.1.9887 WP_000036734.1.98899 WP_000036734.1.98931 WP_000036734.1.98947 WP_000036734.1.9898 WP_000036734.1.9899 WP_000036734.1.99040 WP_000036734.1.99057 WP_000036734.1.99071 WP_000036734.1.99072 WP_000036734.1.99073 WP_000036734.1.99083 WP_000036734.1.99097 WP_000036734.1.99098 WP_000036734.1.99107 WP_000036734.1.99163 WP_000036734.1.99164 WP_000036734.1.99184 WP_000036734.1.9919 WP_000036734.1.99197 WP_000036734.1.99198 WP_000036734.1.99215 WP_000036734.1.99219 WP_000036734.1.99255 WP_000036734.1.99267 WP_000036734.1.99276 WP_000036734.1.99278 WP_000036734.1.99320 WP_000036734.1.99327 WP_000036734.1.99335 WP_000036734.1.99339 WP_000036734.1.99350 WP_000036734.1.99360 WP_000036734.1.99363 WP_000036734.1.99369 WP_000036734.1.99370 WP_000036734.1.99388 WP_000036734.1.99397 WP_000036734.1.99426 WP_000036734.1.99456 WP_000036734.1.99463 WP_000036734.1.99469 WP_000036734.1.99483 WP_000036734.1.99490 WP_000036734.1.99493 WP_000036734.1.99531 WP_000036734.1.9954 WP_000036734.1.99546 WP_000036734.1.99561 WP_000036734.1.99579 WP_000036734.1.99595 WP_000036734.1.99613 WP_000036734.1.99626 WP_000036734.1.99630 WP_000036734.1.99637 WP_000036734.1.99646 WP_000036734.1.99657 WP_000036734.1.99660 WP_000036734.1.99671 WP_000036734.1.99676 WP_000036734.1.99712 WP_000036734.1.99725 WP_000036734.1.99747 WP_000036734.1.99764 WP_000036734.1.99783 WP_000036734.1.99813 WP_000036734.1.99824 WP_000036734.1.99829 WP_000036734.1.99837 WP_000036734.1.99841 WP_000036734.1.99858 WP_000036734.1.99889 WP_000036734.1.9992 WP_000036734.1.99924 WP_000036734.1.99958 WP_000036734.1.99961 WP_000036734.1.99996 gi|62181456|ref|YP_217873.1| gi|197363824|ref|YP_002143461.1| gi|205353892|ref|YP_002227693.1| ABAK02000001|CDS_2403267-2401969 ABAM02000001|CDS_3473186-3471888 ABEH02000003|CDS_117132-115834 ABEI01000005|CDS_128796-127498 ABEJ01000004|CDS_124916-123618 ABEL01000005|CDS_117241-115943 ABEW01000002|CDS_465348-466646 ABFF01000007|CDS_100693-101991 ABFG01000005|CDS_124718-126016 ABFH02000001|CDS_2087255-2088553 AE006468|CDS_3098662-3097364 AE014613|CDS_2931508-2930210 AE017220|CDS_3052100-3050802 AL513382|CDS_2945614-2944316 AM933172|CDS_2981079-2979781 AM933173|CDS_2971519-2970221 CP000026|CDS_2909066-2907768 CP000857|CDS_3031660-3030362 CP000880|CDS_14218-15516 CP000886|CDS_3053539-3052241 CP001113|CDS_3076730-3075432 CP001120|CDS_3072665-3071367 CP001127|CDS_3002936-3001638 CP001138|CDS_3008435-3007137 CP001363|CDS_3118472-3117174 FM200053|CDS_2904724-2903426 FN424405|CDS_3090673-3089375 NZ_ACBF01000001|CDS_235209-233911 gi|16766258|ref|NP_461873.1| gi|549480370|ref|YP_008614591.1| gi|383497622|ref|YP_005398311.1| gi|340000500|ref|YP_004731384.1| gi|378446308|ref|YP_005233940.1| gi|16761724|ref|NP_457341.1| gi|525829209|ref|YP_008252262.1| gi|550902317|ref|YP_008671409.1| gi|526221354|ref|YP_008267157.1| gi|525858724|ref|YP_008262088.1| gi|197250401|ref|YP_002147854.1| gi|378956575|ref|YP_005214062.1| gi|525946300|ref|YP_008307430.1| gi|379702209|ref|YP_005243937.1| gi|161501993|ref|YP_001569105.1| gi|549725522|ref|YP_008645712.1| gi|538363527|ref|YP_008506812.1| gi|488655322|ref|YP_007927125.1| gi|526228928|ref|YP_008323571.1| gi|378451706|ref|YP_005239066.1| gi|194449785|ref|YP_002046912.1| gi|409246635|ref|YP_006887339.1| gi|56414896|ref|YP_151971.1| gi|29143208|ref|NP_806550.1| gi|378700863|ref|YP_005182820.1| gi|452123231|ref|YP_007473479.1| gi|207858212|ref|YP_002244863.1| gi|529220813|ref|YP_008382209.1| gi|378985544|ref|YP_005248700.1| 209261.t2853 220341.STY3081 272994.SPAB_03665 295319.SPA2809 321314.SC2886 41514.SARI_00009 423368.SNSL254_A3168 439843.SeSA_A3110 454166.SeAg_B3085 454169.SeHA_C3149 476213.SPC_3002 550537.SEN2791 550538.SG2856 554290.SSPA2616 99287.STM2952 gi|482905515|ref|YP_007904075.1| gi|528820768|ref|YP_008361971.1| gi|194442471|ref|YP_002042197.1| gi|378990276|ref|YP_005253440.1| gi|161615873|ref|YP_001589838.1| gi|194735542|ref|YP_002115903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]