SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 41514.SARI_02433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41514.SARI_02433
Domain Number 1 Region: 87-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000209
Family NfeD domain-like 0.0061
Further Details:      
 
Weak hits

Sequence:  41514.SARI_02433
Domain Number - Region: 31-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00131
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 41514.SARI_02433
Sequence length 153
Comment (Salmonella enterica arizonae serovar 62 z4 z23 )
Sequence
MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYMLWSGVAAAITGLTVWLLPLGWEWQGVLF
AALTLLAAWLWWRWLARRVREQKPTDRRLNQRGQQLVGRRFMLNAALVNGRGHMRVGDSS
WPVCADEDMCAGTHVEVIAVEGITLRVRAVSST
Download sequence
Identical sequences A0A089GAH2 A0A0V2EAC0 A0A1M3XX13 A0A1X2TLR2 A0A221ZDB0 A0A2K2RXX7 A0A2K2SDP0 A0A2K2SNN9 A0A2K2SYR5 A0A2K2TCG7 A9MLX3
gi|161504325|ref|YP_001571437.1| WP_000561182.1.100979 WP_000561182.1.101363 WP_000561182.1.1204 WP_000561182.1.13465 WP_000561182.1.17694 WP_000561182.1.1832 WP_000561182.1.18796 WP_000561182.1.20438 WP_000561182.1.2155 WP_000561182.1.22026 WP_000561182.1.26414 WP_000561182.1.27123 WP_000561182.1.2915 WP_000561182.1.2974 WP_000561182.1.3208 WP_000561182.1.4114 WP_000561182.1.45947 WP_000561182.1.49041 WP_000561182.1.52052 WP_000561182.1.5907 WP_000561182.1.59204 WP_000561182.1.64715 WP_000561182.1.65308 WP_000561182.1.6558 WP_000561182.1.70262 WP_000561182.1.70692 WP_000561182.1.73242 WP_000561182.1.74673 WP_000561182.1.75150 WP_000561182.1.77861 WP_000561182.1.79300 WP_000561182.1.80363 WP_000561182.1.81612 WP_000561182.1.90617 WP_000561182.1.90752 WP_000561182.1.9276 WP_000561182.1.94461 WP_000561182.1.98266 WP_000561182.1.98558 41514.SARI_02433 CP000880|CDS_2354466-2354927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]