SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0118
Domain Number 1 Region: 43-202
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.44e-26
Family Clp protease, ClpP subunit 0.016
Further Details:      
 
Domain Number 2 Region: 386-445
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000301
Family NfeD domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0118
Sequence length 458
Comment (Hyperthermus butylicus)
Sequence
MNLGRGVYRQRTSMIAAGVLVIVLGLALLAASSMARPAGDLVVVAEVYGVIDSAMCNYVN
DAITYAHESHAKLLVILLNTPGGSLDAALCITEAISKSPVPVAGFVVERWAVSAGTMILM
CSHYAAMQPGTIIGAVQPVALTPTGTYQPINESKMLNPVYKKIEACMRLYNRNITVAKRF
VYENLVLTAEEAVKIHVVEAVAVNIHDLLAKINGSKVNMVSGQTEIVLHDPVVEYYSMPL
GQRILHYLSDPLVSSIFSSIGILLLIVALASGTLQLAVVAIALLLLSFIGFGLAASLAAA
ALILFGLILIGVELFVTPGFGIIGFTGIALTLLGVLIGFTGKPTYIAGESLRVAQRILIA
VIVPLSGLMGIVVYKAARAWRRKPVYMPLPVGKQGRAIDEMPPGGTGFVMVEGEYWQARN
VGRRIIRRDEKVRVVGKDGVTLLVVPYEEGGTTGKAST
Download sequence
Identical sequences A2BJ32
WP_011821310.1.50451 gi|124027018|ref|YP_001012338.1| 415426.Hbut_0118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]