SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416269.APL_0353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416269.APL_0353
Domain Number 1 Region: 120-298
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.85e-42
Family D-glucarate dehydratase-like 0.00000715
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.5e-25
Family Enolase N-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 416269.APL_0353
Sequence length 320
Comment (Actinobacillus pleuropneumoniae L20)
Sequence
MRKAELYRYAIPCQTGVVLRKQPLIQREGLILKLEENGKIGLGEIAPLPGFSQETLADAE
MQAKMWLANQTDDLEELFPSVAFGISCALAELRNELITQGKFASAILCDGNFTQFAQKIA
RIPQPLGKIKIGFEPEKEGELANRLLEQFPHLTLRLDANRSFSLAQAVGFGKKIAKSNRL
RIQFIEEPCFTPSFSRQFAQATGIAIAWDESVREAGFNVKAEDYLKAIVIKPTLTGSLAK
CVNLIKQAHTQGLKAVISSSLESSLGLSQLARIAAQYTPETVAGLDTLGLMQVQLVRAWQ
GADLPLAGLQSRFLQKIAEI
Download sequence
Identical sequences A0A0S4Q7Y7 A3MZ71 B0BTA3 D9P561 D9P9K9
gi|165975811|ref|YP_001651404.1| gi|126207837|ref|YP_001053062.1| 416269.APL_0353 434271.APJL_0369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]