SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416348.Hlac_0560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  416348.Hlac_0560
Domain Number - Region: 95-158
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00471
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 416348.Hlac_0560
Sequence length 205
Comment (Halorubrum lacusprofundi ATCC 49239)
Sequence
MDVLVQSGLLSPDTLPLLLLTAGLLLSMAEALAPGANFIVVGIALIGAGLGGLLLTSLGV
AGAGLTLVMAVLTLLFGAAAFYGYHEFDLYGGKGQQQTSDSDALKGKTGTVTEEVTTAGG
EVKLSGGGFNPYYAARSIEGTIEEGEEVMVVDPGGGNVVTVESMGYVEDDIDKELAADRA
RKEAQRAADASVDDEREPETETERE
Download sequence
Identical sequences B9LTM8
416348.Hlac_0560 WP_012659797.1.44229 WP_012659797.1.66911 WP_012659797.1.80915 gi|222478995|ref|YP_002565232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]