SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416348.Hlac_1825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416348.Hlac_1825
Domain Number 1 Region: 132-397
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.36e-91
Family Enolase 0.000000948
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.53e-38
Family Enolase N-terminal domain-like 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 416348.Hlac_1825
Sequence length 400
Comment (Halorubrum lacusprofundi ATCC 49239)
Sequence
MTRITGISLRRVLDSRGNPTVEADVLTESGGFGRGAAPSGASTGEYEAIELPANESIAKA
REHAVPRLEGVYAGDQRAVDNALRAADGTDDFSAIGANSAVAISMAAAKAAADVLGAPLY
QHLGGAFRGENFPIPLGNVVGGGEHAKEATHIQEFLAAPVGAPSVSEAVFANAAVHAAVA
DVLDERGVPAAKGDEGAWAPPISDADAFEVVDEAVDRVEEDVGFEIRFGLDMAAAELYDD
DQEAYVYGEETKSTDEQIDYVADLVDEYDLAYVEDPLDENDYEAFAELTDRVGDRTMICG
DDLFVTNVERLQEGIDTGAANSILIKPNQIGTLSDTFDAIELAARNGYETIISHRSGETE
DTTIAHLAVATDAGFIKTGTVGGERTAKLNELVRIADDAV
Download sequence
Identical sequences B9LPW6
WP_015910538.1.44229 WP_015910538.1.66911 WP_015910538.1.80915 gi|222480237|ref|YP_002566474.1| 416348.Hlac_1825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]