SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416348.Hlac_2242 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416348.Hlac_2242
Domain Number 1 Region: 131-404
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-75
Family D-glucarate dehydratase-like 0.0000346
Further Details:      
 
Domain Number 2 Region: 37-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-24
Family Enolase N-terminal domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 416348.Hlac_2242
Sequence length 412
Comment (Halorubrum lacusprofundi ATCC 49239)
Sequence
MVDHDKLRDPNAEYTMRDLSAETMDITNSRGGVRDAEITDVQTTMVDGNYPWILVRVYTD
AGVVGTGESYWGGGDTAIIERMKPFIVGENPLDIDRLYEHLVQKMSGEGSISGKVISAIS
GIEIALHDAAGKLLDVPAYQLVGGKYRDEVRVYCDLHTENEADPQACAAEAERVVENFGY
DAIKFDLDVPSGHEKDRANRHLRNPEIDHKVDIVEATTEAVGDKADVAFDCHWSFTGGSA
KRLAEALEEYDVWWLEDPVPPENHDVQEEVTKSTTTPIAVGENVYRKHGQRTLLEPQAVD
IVAPDLPRVGGMRETRKIADLADMYYIPVAMHNVSSPIGTMASAHVGAAIPNSLALEYHS
YELGWWEDLVEEDNLIEEGRMEIPEEPGLGLTLNLDAVGEHMVEGETLFDEA
Download sequence
Identical sequences B9LRU5
416348.Hlac_2242 WP_015910940.1.44229 WP_015910940.1.66911 WP_015910940.1.80915 gi|222480652|ref|YP_002566889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]