SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416591.Tlet_1601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416591.Tlet_1601
Domain Number 1 Region: 72-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000275
Family NfeD domain-like 0.0027
Further Details:      
 
Weak hits

Sequence:  416591.Tlet_1601
Domain Number - Region: 3-96
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0169
Family ABC transporter transmembrane region 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 416591.Tlet_1601
Sequence length 144
Comment (Thermotoga lettingae TMO)
Sequence
MEPYLFWLILGVIFVVGEIFTPSFFLFWFGIGAFVASAVSVSFGTLAQIMVFILVSGLLV
ILTRPLTKKLTKQEPRKIHIDEIIGQIATVIETIDNKQGKGLVKINGDLWRAYSKDEQVI
NEGEKVKIIKVEGSHVIVEKTGGE
Download sequence
Identical sequences A8F7M1
WP_012003631.1.46269 WP_012003631.1.88676 WP_012003631.1.90183 gi|157364452|ref|YP_001471219.1| 416591.Tlet_1601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]