SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416870.llmg_0447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416870.llmg_0447
Domain Number 1 Region: 785-1167
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.54e-117
Family PFOR PP module 0.0000000138
Further Details:      
 
Domain Number 2 Region: 412-660
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.79e-76
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000413
Further Details:      
 
Domain Number 3 Region: 3-255
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.53e-68
Family PFOR Pyr module 0.0000000322
Further Details:      
 
Domain Number 4 Region: 257-408
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.000043
Further Details:      
 
Domain Number 5 Region: 667-830
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.07e-21
Family Ferredoxin domains from multidomain proteins 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 416870.llmg_0447
Sequence length 1223
Comment (Lactococcus lactis cremoris MG1363)
Sequence
MKKTMDGNMAAAHIAYAFSEIAVIYPITPSSPMADYTDAWSVAGRKNIWGQRVKITELQS
EAGAAGAMHGVLKAGGLATTYTASQGLLLMLPNMYKMAGELLPAVIHVAARAVAAGALNI
FGDQSDVMSARTTGFAMLAESSVQEVMDLSAVAHLATLEGSVPFLNFFDGFRTSHEIQKI
DVIDYQDLLPMVNQEKLADFRARAMNPDHPTVSGTNQNADIYFQQRETVNAYYEALPEIV
QKYMGKINELRGTDYDLVNYYGAPDATEVIVSMGSVAGTIEQTVDYLNAQGRKVGFLNIH
LYRPFPMENFLEKLPKTVTSVAVLDRTKEAGSNGEPLFLDVQSALFNSNVKEVIGGRYGI
GGKDTRPEHIVSIFDELLKENPKRTFTIGITDDVTNLSLENLSVLDLTPSDTFQAKFWGF
GSDGTVGANKAAIKIIGDHTDKYVQAAFEYDSKKSGGLTISHLRFGDSPINSEYMTATLD
FVACHNMTYVRKYNLIKGLKAGGVFLLNTSWDLEHLSKNLPSEMKRYIAENNIRFYTIDA
MKIAHETGMERRINTIMQVAFFKLAHVMPFDEAYEILKKDAQKYAKKSPTIVEQNLKAMA
LALNGLHEVIVPESWAETTENVIEAVTKETARKKYVFEIVNKTNAFEGDELSVQTLVDNG
MTFGDEPLGTTVSEKRGIALEVPEWNAQACIQCNECSFVCPHAAIRPFLVDEDEWNQAPE
GFHVMDYKGSDGLKYRIQVSVEDCTGCGLCVEACPKKGEALKMIPYEGQEKESVNWAFAQ
TLKTKENPARPGTIAASQFEKPLFEFSGACSGCGETPYIKLLTQMFGDRMMISNATGCSA
IYGGTQATPYTTNEQEQGPAWSNSLFEDNAEYGYGMWLASQTRRQKLAAEVLEALPEMSD
DLQNLAKDWVEHLEDSEGTRARAEKMKGMLASEHFNSPKLDAIYKQKDQFVKPTQWIFGG
DGWAYDIGFGGLDHIVASGADVNILVMDNEVYANTGGQVSKATPASAIAQFAAGGKSSTK
KDLGAMLMTYGEVYVAQIASGANMMQTIRAFDEAEKFKGPSVIIAYTPCISHGLYGGINL
ALDEAKEAVNSGYWQLYRYNPVLEDLGKNPMILDFKKPDFGKVRDFLLTQSRFGNLLKVD
AEHAENLYDKAAKDSRKRFMRYARLSGDLDKFLEREAKALAKKNADLGISTETNLKKERK
TRPVDPEREARRAARKAERAAKK
Download sequence
Identical sequences A0A165FTL1 A2RIF6
416870.llmg_0447 gi|389853641|ref|YP_006355885.1| WP_011834489.1.100658 WP_011834489.1.31408 WP_011834489.1.33726 gi|125623314|ref|YP_001031797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]