SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416870.llmg_1656 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  416870.llmg_1656
Domain Number - Region: 8-69
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0102
Family Sfri0576-like 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 416870.llmg_1656
Sequence length 112
Comment (Lactococcus lactis cremoris MG1363)
Sequence
MISTFDISSDIDIIKIYGHGLGKADYSYYQSIFDSVDLYHGKTKVMFFWSDYEGKEKEQI
HKDFVKGVTNLIEEYGTTFTNKDHGRNLFTKLLLENRLTIQEIPVNALFLNV
Download sequence
Identical sequences A0A165FDV1 A2RLR0
gi|389854821|ref|YP_006357065.1| gi|125624455|ref|YP_001032938.1| 416870.llmg_1656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]