SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 418136.FTW_0697 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  418136.FTW_0697
Domain Number - Region: 26-82
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00589
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 418136.FTW_0697
Sequence length 366
Comment (Francisella tularensis WY96-3418)
Sequence
MEINIDQNTVYFAGLLTLKQINPKLVEKKVSRSKVKLNRIDITKIQALDTAGAYFILKVL
KDLELTKEDLVFDNHKDKNLIELVANNFPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQE
IKASIGFLGAILLGYLTLIRKPYRSFFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLP
LNLMMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSSSAFTSEIGIMKVNEEIDALQT
IGEDPIQRLVLPRITALIISLPVLTVIAMIANIISGIIIADVIAGITPLQFIERLFSNVN
VNHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAV
ALNGVA
Download sequence
Identical sequences A0A0E2ZH47 A0A0G2RP30 Q5NFI7
177416.FTT_1247 393115.FTF1247 418136.FTW_0697 441952.FTM_1119 gi|134301737|ref|YP_001121705.1| WP_003021557.1.101979 WP_003021557.1.10388 WP_003021557.1.11695 WP_003021557.1.17073 WP_003021557.1.17471 WP_003021557.1.1833 WP_003021557.1.19035 WP_003021557.1.2301 WP_003021557.1.25812 WP_003021557.1.26192 WP_003021557.1.26690 WP_003021557.1.31410 WP_003021557.1.35965 WP_003021557.1.36081 WP_003021557.1.3831 WP_003021557.1.38368 WP_003021557.1.38474 WP_003021557.1.38662 WP_003021557.1.39861 WP_003021557.1.40634 WP_003021557.1.42944 WP_003021557.1.44744 WP_003021557.1.47286 WP_003021557.1.52816 WP_003021557.1.53326 WP_003021557.1.5563 WP_003021557.1.56738 WP_003021557.1.5829 WP_003021557.1.59625 WP_003021557.1.60146 WP_003021557.1.61154 WP_003021557.1.65967 WP_003021557.1.66077 WP_003021557.1.66092 WP_003021557.1.66463 WP_003021557.1.67317 WP_003021557.1.75261 WP_003021557.1.77053 WP_003021557.1.78037 WP_003021557.1.80616 WP_003021557.1.82545 WP_003021557.1.87851 WP_003021557.1.95561 WP_003021557.1.98147 YP_170205.1.84429 gi|379726147|ref|YP_005318333.1| gi|187931809|ref|YP_001891794.1| gi|56708309|ref|YP_170205.1| gi|110670780|ref|YP_667337.1| gi|379717543|ref|YP_005305879.1| gi|385795005|ref|YP_005831411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]