SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 419610.Mext_0049 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419610.Mext_0049
Domain Number 1 Region: 445-535
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000151
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 419610.Mext_0049
Sequence length 556
Comment (Methylobacterium extorquens PA1)
Sequence
MTGLGSTTRTSTTDAPTKLRSDILAGLTAAAVVLPKAMAFATVAGLPVAVGLYTAFVPTL
IYGLLGSSHVLSVSSTTTLAILTAAEIGSVVPDGDPARLVATTATLTALVGALLLGARLV
KLGFIASFISVPVLTGFKAGIACVILLDQAPKLLGLHSAKQSFFIDLASLVRHLPETSLP
TLAVAGVTLAVLVGAERLRPHSPVPLVTVAAAVAASWLLGLNAWGVATVGEIPPGLPSVS
MPDLTLVQALLPGAMGIALMSFTESIAAGRAFVASGDPPIDANRELVATGAANLGGALLG
AMPAGGGASQTGVVRAAGGRTQAASFVTAALALATMLLLSPVLGLLPQATLAAVVIVYSA
SLIQPAEFRDIFKVRRMEFHWAIVAGIGVLVFGTLQGITVAIVLSLVGLGLQTAHPRISV
IARKHGADVLRPLSPEHPDDETFVGLLILRPEGRLYFANAQNVADRIRALIAEHKPRIVA
LDLSRVPDIEYSALQMLRDGARRTSMTFWLVGLNPDVLNMVRRAGLDQELGPDRLLFNAR
TAIERYKALLAPSAPD
Download sequence
Identical sequences A9W7B4
gi|163849505|ref|YP_001637548.1| 419610.Mext_0049 WP_012251873.1.40058 WP_012251873.1.62458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]