SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 419665.Maeo_0223 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419665.Maeo_0223
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000103
Family ArsR-like transcriptional regulators 0.051
Further Details:      
 
Weak hits

Sequence:  419665.Maeo_0223
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0107
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 419665.Maeo_0223
Sequence length 262
Comment (Methanococcus aeolicus Nankai-3)
Sequence
MKKRNITEFQILSEIVRKQPHIKQKEIADVLGITVQGVSEHIRNLLKKGLITSRGRGEYV
LTADGMKALKVWISDFKSYLNHVNQDIYRYKDVWPAIANEDLKEGDEVYLYMNKGHLYAS
KEVKSKSTAKVSEGGYAGEDIAIENINGIIEIKKGKVIILKIPPKVKGGSKNVDYEVIQN
ILDANRDSVVATMGTISHVVSKKLNIKPEIRFAVLEGIVGACDRGCDVVCLITGKMTEKV
VKTLDKHKISYSVIDCAKDVDN
Download sequence
Identical sequences A6UTJ3
gi|150400661|ref|YP_001324427.1| 419665.Maeo_0223 WP_011972947.1.55018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]