SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 419665.Maeo_0609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419665.Maeo_0609
Domain Number 1 Region: 143-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.56e-117
Family Enolase 0.0000000956
Further Details:      
 
Domain Number 2 Region: 11-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-54
Family Enolase N-terminal domain-like 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 419665.Maeo_0609
Sequence length 429
Comment (Methanococcus aeolicus Nankai-3)
Sequence
MLKNMDNSFDILDIKAREVIDSRGNPTVEVEVLTAGGYGSAIVPSGASTGTHEAVELRDK
SQRFGGKGVLVAVDNVNSIIAPELIGFDSRTQREIDTYMIELDRTANKGKLGANAILAVS
MAVAKAAASTASLPLYKYIGGCNSYIMPVPMMNVINGGEHAGNALEFQEFMIMPVGADSI
SEAIRMCAETYHTLKKVIVSKYGKNASNVGDEGGFAPPVSDIRETLDLLTDAVKMAGYED
EITFALDCAASEFYNKDDNKYIVKGAPLSSDQLISLYKEICDEYPVISIEDPLDEEDFEG
FASLTKELKGVQIVGDDLFVTNTERLKKGIEMGAGNALLLKVNQIGTLSESIDAANLAFR
NGYGVVVSHRSGESEDNTIADISVALNAGQIKTGAPARGERTAKYNQLIRIEEEIGYPKY
AGKNIRCPF
Download sequence
Identical sequences gi|150401040|ref|YP_001324806.1| 419665.Maeo_0609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]