SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 419665.Maeo_0770 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419665.Maeo_0770
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000275
Family NfeD domain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 419665.Maeo_0770
Sequence length 146
Comment (Methanococcus aeolicus Nankai-3)
Sequence
MGMSLGQIFMLIGLGLILLEVITPGLYFPAIGIALLIYGVFLIYLPSLALPTAILSGLIT
IYIMYRLVYGVGADIKIGADRFIGREITLTEDLDDQNYGSIIIDNEQWYIKSKSAGKRLK
KGDIVKIVGIEGVSLIVENIDDIEHI
Download sequence
Identical sequences A6UV31
gi|150401199|ref|YP_001324965.1| 419665.Maeo_0770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]