SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 419942.YN1551_2679 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419942.YN1551_2679
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.2e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 419942.YN1551_2679
Sequence length 182
Comment (Sulfolobus islandicus Y N 15 51)
Sequence
MTLIELALRGRGGQGIVTAGELVTKAMVLEDKYAQSIPFFGGERRGAPVVSFLRLSDKPI
LLHREVYNPDGVAIFDTSLIQIINVTEGLKENGFLLLNTNTPNRIWKSEYIVDATSIAKE
LGLVVAGWAVVNTAMIGALVKILGQPSLHSLEEAVKEEFPGKIGELNAEAVEMGYKGVKS
VD
Download sequence
Identical sequences C3ML14 C3N9Y5 C3NLP0 D2PFY0
gi|227829405|ref|YP_002831184.1| WP_012712965.1.13477 WP_012712965.1.34992 WP_012712965.1.52267 WP_012712965.1.66823 419942.YN1551_2679 429572.LS215_0398 439386.YG5714_0376 gi|229583116|ref|YP_002841515.1| gi|284996777|ref|YP_003418544.1| gi|229578193|ref|YP_002836591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]