SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 420247.Msm_1472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  420247.Msm_1472
Domain Number - Region: 218-244
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0745
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 420247.Msm_1472
Sequence length 306
Comment (Methanobrevibacter smithii ATCC 35061)
Sequence
MSLIIAYIGKKGCVMASDKRRIGYFGNKEQLNALESELYSGKIKTDEEFKKKADEYGISI
KLTEDATKITTVGNCVRGEVTTKKVFETYRKRIYGTTMGYQIVELSGSETVSREAGEKAI
IVFGNKFAKQEAEKLINKKWKPSLSLKYMGDIFEEILTEISRKTPTIGNTFDVLIKQPKF
NKSEAQRHLNVSIDKDIKVLSKFRQKLQEDLIQKNKEIALADKIINKGDVGEVVSVDGKM
LHVKLNSKTQAFDGNWKQIAKPNETVFMFSDHNHVELGDKVVIQDEKLCLKKDKSNLKCD
IILCSL
Download sequence
Identical sequences A0A1D2WSQ2 A5UN99 B9AE10
2004014653 420247.Msm_1472 gi|148643532|ref|YP_001274045.1| WP_004035387.1.44750 WP_004035387.1.59899 WP_004035387.1.83718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]