SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 420662.Mpe_A0970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  420662.Mpe_A0970
Domain Number 1 Region: 141-418
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.88e-78
Family D-glucarate dehydratase-like 0.00000000253
Further Details:      
 
Domain Number 2 Region: 9-139
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.85e-31
Family Enolase N-terminal domain-like 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 420662.Mpe_A0970
Sequence length 450
Comment (Methylibium petroleiphilum PM1)
Sequence
MLNTSLSSTPRVTAMRVIPVAGRDSMLMNLSGAHGPFFTRNLVILSDNAGRSGVGEVPGG
EKIRQTLEDAREWVVGQPVGDVQRVLRTVRERFADRDAGGRGLQTFDLRTTIHVVTAVES
ALLDLLGQHLELPVAALLGEGQQRTSVEMLGYLFFVGDRTKTDLAYAGPADEATDADDWQ
RLRHEPAMTPEEVVRLAEAARARYGFNDFKLKGGVLAGDAEVDAVTAIHERFPDARVTLD
PNGGWLLKDAIRLGQRMRGVVAYAEDPCGAEEGYSGREVMAEFRRATGLPTATNMVATDW
RQLTHALSLQSVDIPLADPHFWTMAGSVRVAQTCRDWGLTWGSHSNNHFDVSLAMFTHVG
AAAPGRVTAIDTHWIWQDGQRLTKEPLQIVGGHVRVPQRPGLGIELDMAEVEKAHRLYLE
HGLGARDDAVAMQHLIPNWRFDPKRPCMLR
Download sequence
Identical sequences A2SEE3
gi|124266163|ref|YP_001020167.1| 420662.Mpe_A0970 WP_011828570.1.77188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]