SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 423368.SNSL254_A3183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  423368.SNSL254_A3183
Domain Number 1 Region: 138-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.92e-84
Family D-glucarate dehydratase-like 0.00000000354
Further Details:      
 
Domain Number 2 Region: 7-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.48e-32
Family Enolase N-terminal domain-like 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 423368.SNSL254_A3183
Sequence length 446
Comment (Salmonella enterica serovar Newport SL254)
Sequence
MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGVGEAPGGEVI
YQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGQALNVPVCELLGPGKQRDAVTVLGYLFYIGDRTKTDLPYLESTPGSHEWYRLRHQE
ALNSDAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAIALCKGLKDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLTGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGK
PTAIDTHWIWQEGDCRLTKNPLEIKNGKIAVPDAPGLGVELDWEQVRKAHDAYKKLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
Download sequence
Identical sequences A0A0H3BPE2 A0A0R9MWM1 A0A1S1A6M4 A0A1U7FRV5 A0A221YPJ6 A0A249UV52 S5HZ14 V1X0W1 V7IEY6
WP_000211801.1.13101 WP_000211801.1.13311 WP_000211801.1.15625 WP_000211801.1.18178 WP_000211801.1.20330 WP_000211801.1.22514 WP_000211801.1.23755 WP_000211801.1.2554 WP_000211801.1.25703 WP_000211801.1.27713 WP_000211801.1.28673 WP_000211801.1.29099 WP_000211801.1.29255 WP_000211801.1.29774 WP_000211801.1.29924 WP_000211801.1.30179 WP_000211801.1.30803 WP_000211801.1.31952 WP_000211801.1.32408 WP_000211801.1.33629 WP_000211801.1.36839 WP_000211801.1.40528 WP_000211801.1.41789 WP_000211801.1.44438 WP_000211801.1.47389 WP_000211801.1.47714 WP_000211801.1.51131 WP_000211801.1.51162 WP_000211801.1.53694 WP_000211801.1.57735 WP_000211801.1.58604 WP_000211801.1.6210 WP_000211801.1.63129 WP_000211801.1.6399 WP_000211801.1.68210 WP_000211801.1.72068 WP_000211801.1.72220 WP_000211801.1.74946 WP_000211801.1.90311 WP_000211801.1.90866 WP_000211801.1.92047 WP_000211801.1.93596 WP_000211801.1.99725 ABAK02000001|CDS_2425498-2424158 ABEI01000005|CDS_151027-149687 CP001113|CDS_3097579-3096239 gi|194443156|ref|YP_002042212.1| gi|525858738|ref|YP_008262104.1| 423368.SNSL254_A3183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]