SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426117.M446_0125 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426117.M446_0125
Domain Number 1 Region: 141-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.9e-97
Family Enolase 0.00000129
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.4e-43
Family Enolase N-terminal domain-like 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 426117.M446_0125
Sequence length 433
Comment (Methylobacterium 4 46)
Sequence
MTSMTITSVHGRRLWDSRGRPTVEVEVTVGGHAVGRAIAPAGASTGSGEAIDLRDGGEAF
GGLDVRRAIGNVNGPIARALVGMDASDPPAIDAAMIALDGTPDKSRLGGNATVATSMAVL
HARARAVGLPVWKLLAGSRQVRIPLPEIQIFGGGAHAERRVDIQDFMVMCPGAGSFAEAL
DWTAEIYRAAGALMRRAGKLQGVADEGGYWPVFASNEEALDTLMLALEAAGFRPGADVAI
SLDVAASEFGRAGAYVLALDGRTLDTAGMIDMLGSWLDAYPIVSIEDPVAEDDVDGFKAF
TASYGRHCQIIGDDFFVTDAKRVTRAAGDRSANAVLIKPNQAGTLAETHAALLAAKEAGF
GTIVSARSGETEDTTIAHLAVGWDAGQLKVGSFSRSERMAKWNEVLRIEECLGDDAVFAG
WSALPFKEAAPSS
Download sequence
Identical sequences B0UPU6
WP_012330128.1.13143 WP_012330128.1.41957 426117.M446_0125 gi|170738489|ref|YP_001767144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]