SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426117.M446_2088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426117.M446_2088
Domain Number 1 Region: 113-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.88e-56
Family D-glucarate dehydratase-like 0.00044
Further Details:      
 
Domain Number 2 Region: 7-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.69e-24
Family Enolase N-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 426117.M446_2088
Sequence length 364
Comment (Methylobacterium 4 46)
Sequence
MRPEAPIDAVTARAYAVPTDAAEADGTFAWHRTTLVVVEVAAGDRRGLGYTYSDAGNAGL
VKGTLSPLLKGGDPFDVPALTARLRRRVRNLGRAGLAATAISALDAALWDLKARLLDLPL
VRLLGAARPAVAIYGSGGFTSYGEARLTAQLAGFVERDGCRAVKMKIGSDPDRDPDRMRA
ARAAIGGAALFIDANGAFSPRAALAMAETAAGLGVRWFEEPVSSDDRAGLRFVRERVPAG
IDVAAGEYAYSLDDVRHMLEAGAVDVQQADATRCGGVSGFLAAGALCEAHHTDLSGHCAP
ALHLHPACAAARVRHLEWFHDHVRIESMLFDGAPVPREGRIAPDLGRPGHGLTFKHQDAE
RYAV
Download sequence
Identical sequences B0UBF5
gi|170740330|ref|YP_001768985.1| WP_012331960.1.41957 426117.M446_2088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]