SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426118.M164_0398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426118.M164_0398
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.03e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 426118.M164_0398
Sequence length 182
Comment (Sulfolobus islandicus M 16 4)
Sequence
MTLIELALRGRGGQGIVTAGELVTKAMVLEDKYAQSIPFFGGERRGAPVVSFLRLSDKPI
LLHREVYNPDGVAIFDTSLIQIINVTEGLKENGFLLLNTNTPKRIWKSEYIIDATSIAKE
LGLVVAGWAVVNTAMIGALVKILGQPSLHSLEETVKEEFPGKIGELNAEAVEMGYKGVKR
VD
Download sequence
Identical sequences C3MUM0 C3N1Y9 C4KDQ6
gi|229583943|ref|YP_002842444.1| gi|238618872|ref|YP_002913697.1| WP_012710531.1.100559 WP_012710531.1.27461 WP_012710531.1.44962 WP_012710531.1.47130 WP_012710531.1.48461 WP_012710531.1.60638 WP_012710531.1.68242 WP_012710531.1.74483 WP_012710531.1.83431 WP_012710531.1.84481 WP_012710531.1.90709 WP_012710531.1.97021 gi|227826773|ref|YP_002828552.1| 426118.M164_0398 427317.M1425_0374 427318.M1627_0382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]