SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426118.M164_2550 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426118.M164_2550
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 426118.M164_2550
Sequence length 184
Comment (Sulfolobus islandicus M 16 4)
Sequence
MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGAEIEAYCRISENPIRV
TSPVEEPDYLVVIDNSLLQISRNLFRGLKDTSTIILNSPSKPDLNWRTFHVNATKIATDL
GLVKSGWPMVNVIILGALIRVMGVPKLSSLEQAIEEEFGGKIAELNIKGARLAYEQVGVE
YVTA
Download sequence
Identical sequences C3MSY1 C3N2V9 C4KEA4 M9UGR5
gi|479326786|ref|YP_007866843.1| gi|229585999|ref|YP_002844501.1| gi|238620984|ref|YP_002915810.1| WP_012712478.1.100559 WP_012712478.1.27461 WP_012712478.1.44962 WP_012712478.1.47130 WP_012712478.1.48461 WP_012712478.1.60638 WP_012712478.1.68242 WP_012712478.1.74483 WP_012712478.1.83431 WP_012712478.1.84481 WP_012712478.1.89621 WP_012712478.1.90709 WP_012712478.1.91160 WP_012712478.1.97021 gi|227828792|ref|YP_002830572.1| 426118.M164_2550 427317.M1425_2566 427318.M1627_2619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]