SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426355.Mrad2831_5110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  426355.Mrad2831_5110
Domain Number - Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0405
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 426355.Mrad2831_5110
Sequence length 151
Comment (Methylobacterium radiotolerans JCM 2831)
Sequence
MTIASLAGTFEALGAAWSWVIAGLVLAGAEILLPGVFLIWLGLAAVATGLAAAALPMPWQ
GQTLLFAGLAVALVALATRLQRRGKGTGPELNRADRGLIGREGVLDEPIVRGAGRIRFDD
TLWRVEGPDLPAGRRVRVTGIGGTVLRVEAA
Download sequence
Identical sequences A0A0E9K790 A0A154NCS8 B1LV61
gi|170751490|ref|YP_001757750.1| 426355.Mrad2831_5110 WP_012322014.1.25698 WP_012322014.1.31760 WP_012322014.1.35747 WP_012322014.1.5195 WP_012322014.1.89921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]