SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426368.MmarC7_0560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426368.MmarC7_0560
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.98e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 426368.MmarC7_0560
Sequence length 177
Comment (Methanococcus maripaludis C7)
Sequence
MRKEIRFSGFGGQGIILAGVILGRAASLYAGKEAVQTQSYGPEARGGASKSEVVISESEI
DFPKVIQPDILISMSQPAFDKYGYDLKENAKVIVDRDLVTIPNGYEGKYEVYKVPFTEIA
NKEVGLGIVANIVMLGALTKLAELVSKEEVEKALLDSIPKGTEKKNLMAFEKGYDYL
Download sequence
Identical sequences A6VGQ2
gi|150402485|ref|YP_001329779.1| 426368.MmarC7_0560 WP_011976959.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]