SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426368.MmarC7_1308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426368.MmarC7_1308
Domain Number 1 Region: 200-452
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.4e-64
Family PFOR Pyr module 0.084
Further Details:      
 
Domain Number 2 Region: 7-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 3 Region: 462-567
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000297
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 426368.MmarC7_1308
Sequence length 570
Comment (Methanococcus maripaludis C7)
Sequence
MNLEKEVSIVLGGAAGQGIQTIEESLTKILKLSGYNVFATKEYMSRVRGGINTTEIVISS
EKKRSFLKRIDLLVTFKKGVLNHLKDRISDKTIILGEKENIDEEFLDNKNIIDIPIQEIS
KNIGNTLFSNTVGSGIILGIFDCDLELFNKYLEDKFSKKGEEIVNKNLEAAKEGYLLGKK
ILKDSNFKINLEKNGKLKDEIILSGTEAVALGAAKAGCNFVSFYPMTPSTGVSTFLAGHS
KDLGIIVEQVEDEISAINMAIGSWYAGARGLVTTSGGGFSLMCEAVSLSGMTETPVVVYL
AQRPGPSTGLPTRTAQADLELALYSGHGEFPRIIYSPGKIEEAYEISQIAFNMADKYQIP
VFILSDEYLADTFYNLSDDELKTVKKENHVVKTDFDYKRYQLSENPISERGIPGFGEGIV
LVCGNEHDEFGDITEDVDLINKMTKKRNKKLDLIKKEAIAPEFIGNEDYKNLIVSWGTTY
YPVKDALEKLNLKDTALLHFSQVYPISDSAEKYLKKAEKIINIELNYSGQLGRLLKREFG
TEMNDSILKYDGRAFSVEELTEKIEKVLMG
Download sequence
Identical sequences A6VIU5
426368.MmarC7_1308 WP_012067838.1.31125 gi|150403228|ref|YP_001330522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]