SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426368.MmarC7_1741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426368.MmarC7_1741
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.97e-51
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 426368.MmarC7_1741
Sequence length 188
Comment (Methanococcus maripaludis C7)
Sequence
MNIVIAAVGGQGAVLTSKILGTLAQNLGKDVKVSEVHGMSQRGGSVVAYVKFGDKVYSPV
VEKGTADIVLAFEMLEGARYVDYLKENGKLVVNTQKIDPMPVITGDVKYPSDLSEKIGEL
NIEYIPVDALSIAKNAGTIKAVNVALIGVLAKNSNIKKEEWIKAIKDTVPEKFLELNMKA
FELGYNLE
Download sequence
Identical sequences A6VK21
426368.MmarC7_1741 WP_012068257.1.31125 gi|150403654|ref|YP_001330948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]