SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 427318.M1627_0893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  427318.M1627_0893
Domain Number 1 Region: 113-360
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.5e-51
Family D-glucarate dehydratase-like 0.0000546
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.66e-24
Family Enolase N-terminal domain-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 427318.M1627_0893
Sequence length 375
Comment (Sulfolobus islandicus M 16 27)
Sequence
MKIVDIKAVHVNLPLRTNYKSWTGEHKTQPSIVTIIDTDEGFSGISSIEPDRPNYSEQSW
HEILSTINIDIKGILIGMDPLDLSRINSLMEKLLYGRYMSKAAIDIALNDLKAKYLGVPL
YKLIGGAAIEKIDIIGWIGLEGVEETIKDSLYFIENGFKTLKIKIGKNIEDEVKRIKNLR
DVIGYNVKLRLDANQALTPKSALKLAKEIYKYEIELLEQPVSRDDIEGMRYVNIYSDIPV
MADESVVTPRDLILIAEKRAASIVKLKAMRSGGVSKTKFMFELCKTLNIECIIGHGFSTT
VGALAEAHIAFTIPSIQRACEFVGPLKLIKDISKKSIVQLLQKGYVTVNEISKLGNGLGI
NKDELIFDNDTLFQK
Download sequence
Identical sequences C3N4A3
gi|229584372|ref|YP_002842873.1| WP_012718640.1.27461 WP_012718640.1.74483 427318.M1627_0893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]