SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 428406.Rpic12D_3058 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  428406.Rpic12D_3058
Domain Number 1 Region: 742-986
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0069
Further Details:      
 
Domain Number 2 Region: 29-211
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.12e-21
Family Pyruvate oxidase and decarboxylase Pyr module 0.073
Further Details:      
 
Domain Number 3 Region: 457-643
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000081
Family Pyruvate oxidase and decarboxylase PP module 0.037
Further Details:      
 
Weak hits

Sequence:  428406.Rpic12D_3058
Domain Number - Region: 278-416
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000785
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 428406.Rpic12D_3058
Sequence length 1186
Comment (Ralstonia pickettii 12D)
Sequence
MNAPLNDALRRALETVSLDDKYTLERGRIYISGTQALVRLPMLQQERDRAAGLNTAGFIS
GYRGSPLGALDQALWKAKKHLAGHNIVFQAGLNEDLAATAVWGSQQVNLYPSAKFSGVFG
MWYGKGPGVDRTIDVFKHANSAGSSAHGGVLVLAGDDHAAKSSTLAHQSEHVFKAAGIPV
LYPSNVQEYLDYGLHGWAMSRYSGLWVSMKCVTDVVESSASVDVDPHRAQIILPEDFVMP
QGGLNIRWPDPPLVQEARLLDYKWYAGLSYVRANKLDRVVLDSPQARFGIMTAGKAYLDV
RQALVDLGLDDDTCRRIGIRLYKVGCVWPLEAHGARAFAEGLQEILVVEEKRQILEYQLK
EELYNYRDDVRPRVYGKFDEKDNAGGEWSVPMANWLLPAHYELSPALIARAIATRLEKFE
LPSDVRARIASRIAIIDAKEKALAKPRITAERKPWFCSGCPHNTSTNVPEGSRALAGIGC
HYMTVWMDRRTDTFSQMGGEGVAWIGQMPFSGDQHVFANLGDGTYYHSGLLAIRASIAAK
VNITYKILYNDAVAMTGGQPVDGPLSVPQIAAQVYAEGTSRIVIVTDEPEKYNAAIKLPE
GVTVHHRDRLDAIQRELREVQGTSVLIYDQTCATEKRRRRKRGTMVDPARRAFINDAVCE
GCGDCSVKSNCLSVEPLETELGTKRKINQSSCNKDFSCVNGFCPSFVTAEGAQVRKPESH
GVSMEGLPLLPHPELPAIQRAYGVLVTGVGGTGVVTIGGLLGMAAHIEGKGVTVLDMAGL
AQKGGAVLSHVQIGERPDSIHATRIAMGEADLVIGCDAIVSASDEVLSKVQHGQTRAIIN
STASPTADFIKNPNWRFPGSSAEADIRAAVGDACAFEDANTLAVRLLGDAIFTNPLVLGF
AWQKGWVPLTHDALIRAIELNGVAVEKNKTAFEWGRHLAQDREAVLKLAGDAPRAKADVI
ALPSLDTLIARRVDLLTAYQNAAYAAEFRAVVERVRAAEAAVVGAGQPLALTEAVVRNLS
KLMAYKDEYEVARLYTDPAFLDKLRAQFEGEPGRDYQLNFWLAPPMTAKRDEKGHLVKQR
FGPNTMRIFKVLAKLKGLRGTAFDIFGKTEERRTERALIGEYRALVDELAKGLTAQKLAQ
AVELARLPEDIRGFGHVKEANLAAARIRWNKLLAQWRDPAAAQQAA
Download sequence
Identical sequences A0A2A4A8U1 C6BGH6
gi|241664638|ref|YP_002982998.1| 428406.Rpic12D_3058 WP_015855833.1.7259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]