SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 429009.Adeg_0040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  429009.Adeg_0040
Domain Number 1 Region: 7-132
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 1.77e-33
Family HEPN domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 429009.Adeg_0040
Sequence length 134
Comment (Ammonifex degensii KC4)
Sequence
MRRSPLEEGRRWLEQAEEDLRWAKHLTQQGGYYLACFLSQQIGEKAIKGFLYAQGEEIVL
GHSIERLCHQAARWEPLFAEKVKRWAILDGYYVPTRYPNGLPDSIPARVYTEEAAQEAVR
LAEEVVAFVRDRLA
Download sequence
Identical sequences C9RAA8
gi|260891970|ref|YP_003238067.1| 429009.Adeg_0040 WP_012818197.1.101502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]