SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 429009.Adeg_0941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  429009.Adeg_0941
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.46e-28
Family Clp protease, ClpP subunit 0.01
Further Details:      
 
Domain Number 2 Region: 360-424
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000575
Family NfeD domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 429009.Adeg_0941
Sequence length 425
Comment (Ammonifex degensii KC4)
Sequence
MRKWLLLALLLFLFPGVGAASGRKIVVLTVDGPIMPVTAHYIDRGIELAEHEGAAACLIR
LNTPGGLYSATQKIVSREVNARVPVIVYVTPAGGWAASAGAFITMGGHVAAMAPGTRIGA
AHPVAGGQDQDEVALKKATADAAAWMRSLAQMRGRNAELAEKMVTESRSFSASEALKEKL
IDLVAPGEATLFRELEGKEITLASGQKVELHLVGATLQEVPLTRSEEILSAILTPDVAYL
LLTIGMIGLLVEIYHPGLIIPGVVGGIALLVALYSLGTLDAFWGGLLLLLLSFGFLVAEV
FAPTHGILATGGVIGFILGSLLLFSTRPQGVKVSTGLIAAMSVTLAGLMALLVTAVVRGQ
KRQVQTGEEELIGKLAEVRSPLNPTGIVFLDGELWQAEIEEGEAEVGEKVIVVGKEGLKL
KVKRR
Download sequence
Identical sequences C9RCV0
gi|260892830|ref|YP_003238927.1| 429009.Adeg_0941 WP_015738954.1.101502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]