SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 429572.LS215_0011 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  429572.LS215_0011
Domain Number 1 Region: 55-114
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000000209
Family NfeD domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 429572.LS215_0011
Sequence length 124
Comment (Sulfolobus islandicus L S 2 15)
Sequence
MAHPVAITLIIIAVLIAILVITGYISDPIIDIPTLALLGFLTYRVINVVIKTRGRNLYSY
EGKIGKAVDDIKSGQEGYVIVEGEYWRALALEDIKKNEDIVVVKREGMKLMVRKKVSDIE
TSRV
Download sequence
Identical sequences C3MIV8 C3MTL9 C3MZV5 C3N7T7 C3NJ43 C4KJC7 D2PDS9
gi|284996418|ref|YP_003418185.1| 419942.YN1551_0011 426118.M164_0011 427317.M1425_0011 427318.M1627_0011 429572.LS215_0011 439386.YG5714_0011 gi|238618490|ref|YP_002913315.1| gi|229580733|ref|YP_002839132.1| WP_012710190.1.100559 WP_012710190.1.13477 WP_012710190.1.27461 WP_012710190.1.34992 WP_012710190.1.44962 WP_012710190.1.47130 WP_012710190.1.48461 WP_012710190.1.52267 WP_012710190.1.60638 WP_012710190.1.66823 WP_012710190.1.68242 WP_012710190.1.74483 WP_012710190.1.83431 WP_012710190.1.84481 WP_012710190.1.89621 WP_012710190.1.90709 WP_012710190.1.97021 gi|227826422|ref|YP_002828201.1| gi|227829031|ref|YP_002830810.1| gi|229577829|ref|YP_002836227.1| gi|229583584|ref|YP_002842085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]