SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 429572.LS215_0795 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  429572.LS215_0795
Domain Number 1 Region: 104-368
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-66
Family D-glucarate dehydratase-like 0.00035
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.36e-16
Family Enolase N-terminal domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 429572.LS215_0795
Sequence length 370
Comment (Sulfolobus islandicus L S 2 15)
Sequence
MKISDIKTYRVKIPLRESIQFSWEPFPNTHFEFILIEVVNSKGIKGYSATQFTAQTEVAI
RGLKPLLKGLDVEDFLANDRLLELGSWFFGRIGAIEVALLDLLAKEENLPLYKLFRGNRK
RIRVYASTGRLAKAEEIINLIKKYYDIGIDIVKIRFHRITINDDLNIVKEIRKEFGEQIK
IAVDANQAWGLVSPFWNRYDALKVAKELERYNIEWLEEPLFKDDIEGYAWLRRNTSVKIA
AGELEHNFWIFKKFIEENALDIVQADAIYSNGISECIKIALMAQVNGLLFLPHAWDPGLG
WLANLHLTASLPESLTPYLETPLDPLWWFNDVIQFAFKEGIEIQNGYVRVPEKEGLGIEL
DMEKIKKFIT
Download sequence
Identical sequences C3MN17 C3NCA0 D2PIW9
429572.LS215_0795 439386.YG5714_0823 gi|227829723|ref|YP_002831502.1| gi|284997325|ref|YP_003419092.1| gi|229578632|ref|YP_002837030.1| WP_009989813.1.13477 WP_009989813.1.34992 WP_009989813.1.57434 WP_009989813.1.66823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]